DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and Klf16

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001121076.1 Gene:Klf16 / 690820 RGDID:1305966 Length:251 Species:Rattus norvegicus


Alignment Length:240 Identity:87/240 - (36%)
Similarity:113/240 - (47%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 RAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEIKPILTPIYVSPVASSASQLILLSTVA---- 227
            ||......|..||..|     .|||.|.               .|..|::|..|:..|.:|    
  Rat    44 RATRREATPPGTPGAP-----PPPATAP---------------GSGGATAAPHLLAASILADLRG 88

  Fly   228 ----AQQSPTPVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHT 288
                |..:.|....:|..|....::..:.....|.:|  :.|.||.|.|.|:||||||:|.|.||
  Rat    89 GPGVATAANTAGGTSPVSSSSAASSPSSGRAPGAAKS--HRCPFPGCAKAYYKSSHLKSHLRTHT 151

  Fly   289 GERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKANGV 353
            |||||.|.|..|||:|:|||||:||.|||||||:|.|.:|.|:|.|||||:||.:||...:...:
  Rat   152 GERPFACDWPGCDKKFARSDELARHHRTHTGEKRFPCPLCTKRFTRSDHLTKHARRHPGFRPELL 216

  Fly   354 NR------------HVSLANNNTSASVAASLCDASLHLRAIAPAG 386
            .|            ..|||.:.|.:.|.:.           ||||
  Rat   217 RRPGARSASPSDSLPCSLAGSPTPSPVPSP-----------APAG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 14/23 (61%)
C2H2 Zn finger 265..287 CDD:275368 14/21 (67%)
COG5048 <270..362 CDD:227381 56/103 (54%)
zf-H2C2_2 279..306 CDD:290200 18/26 (69%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 15/22 (68%)
zf-C2H2 323..345 CDD:278523 12/21 (57%)
C2H2 Zn finger 325..345 CDD:275368 11/19 (58%)
Klf16NP_001121076.1 KLF16_N 2..127 CDD:409237 22/104 (21%)
COG5048 124..>186 CDD:227381 42/63 (67%)
C2H2 Zn finger 131..150 CDD:275368 12/18 (67%)
C2H2 Zn finger 158..180 CDD:275368 14/21 (67%)
zf-C2H2 186..208 CDD:395048 12/21 (57%)
C2H2 Zn finger 188..208 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11381
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.