DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and klf9

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001122201.1 Gene:klf9 / 565869 ZFINID:ZDB-GENE-060526-244 Length:216 Species:Danio rerio


Alignment Length:192 Identity:79/192 - (41%)
Similarity:105/192 - (54%) Gaps:16/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 EEIKPILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRITAAQAAATRSR-- 261
            ||.:...|.:.|:.:....:|.| .|.::|::.   |.......|.:...:.||.:...||.|  
Zfish    30 EESQESRTLLMVAMILLDLNQCI-PSGISAKRI---VDSDAENRENREKCKQTAGRVKRTRKRDR 90

  Fly   262 -------IYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTG 319
                   .:.|.:..|||.|.||||||||.|||||||||.|.|..|.|:|||||||:||.|||||
Zfish    91 LHASAEKRHCCPYAGCGKIYGKSSHLKAHFRVHTGERPFQCTWPGCAKKFSRSDELTRHFRTHTG 155

  Fly   320 EKKFQCSVCQKKFMRSDHLSKHVKRHNKDKANGVNRHVSLANNNTSASVAASLCDASLHLRA 381
            ||:|.|.:|.|.|||||||:||.:||.....:.:..|   |.....:|.:.|...:|.|:.|
Zfish   156 EKRFMCPLCDKCFMRSDHLTKHARRHAGFHPSMLQGH---AGRRRHSSTSTSSSGSSDHMSA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 14/23 (61%)
C2H2 Zn finger 265..287 CDD:275368 14/21 (67%)
COG5048 <270..362 CDD:227381 58/91 (64%)
zf-H2C2_2 279..306 CDD:290200 19/26 (73%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 15/22 (68%)
zf-C2H2 323..345 CDD:278523 13/21 (62%)
C2H2 Zn finger 325..345 CDD:275368 12/19 (63%)
klf9NP_001122201.1 C2H2 Zn finger 101..123 CDD:275368 14/21 (67%)
COG5048 113..>161 CDD:227381 37/47 (79%)
C2H2 Zn finger 131..153 CDD:275368 14/21 (67%)
zf-H2C2_2 145..168 CDD:290200 15/22 (68%)
zf-C2H2 159..181 CDD:278523 13/21 (62%)
C2H2 Zn finger 161..181 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.