DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and osr2

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_005173612.1 Gene:osr2 / 550389 ZFINID:ZDB-GENE-050417-183 Length:278 Species:Danio rerio


Alignment Length:186 Identity:59/186 - (31%)
Similarity:84/186 - (45%) Gaps:21/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEIKPILTPIYVS--PVASSASQLILLS 224
            :|||.......|..:..|..|.| |..|.|.|..:      |...|::..  |....|:    |:
Zfish    46 QMNRWTVGFPQLQGLADPRFPGA-LPFPAAAAHLL------PHKHPVHRKDRPRFDFAN----LA 99

  Fly   225 TVAAQQSPTPVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTG 289
            ..|.|:.| ||.....:|.|:...|   .:..|...:.:.|.|  ||:::.||.:|..|:|.||.
Zfish   100 VAATQEDP-PVTGQSRLSPERRPAR---GRLPAKSKKEFICRF--CGRHFTKSYNLLIHERTHTD 158

  Fly   290 ERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRH 345
            |||:.|  :.|.|.|.|.|.|..|:..|:.||.|:|..|.|.|.:|..|:.|...|
Zfish   159 ERPYTC--DICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 9/23 (39%)
C2H2 Zn finger 265..287 CDD:275368 9/21 (43%)
COG5048 <270..362 CDD:227381 32/76 (42%)
zf-H2C2_2 279..306 CDD:290200 12/26 (46%)
C2H2 Zn finger 295..317 CDD:275368 8/21 (38%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
osr2XP_005173612.1 COG5048 <55..>276 CDD:227381 56/177 (32%)
C2H2 Zn finger 136..156 CDD:275368 9/21 (43%)
zf-H2C2_2 148..173 CDD:290200 12/26 (46%)
C2H2 Zn finger 164..184 CDD:275368 8/21 (38%)
zf-H2C2_2 176..199 CDD:290200 9/22 (41%)
C2H2 Zn finger 192..212 CDD:275368 7/19 (37%)
zf-C2H2 218..240 CDD:278523
C2H2 Zn finger 220..240 CDD:275368
C2H2 Zn finger 248..268 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.