DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and osr1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001006079.1 Gene:osr1 / 450059 ZFINID:ZDB-GENE-070321-1 Length:264 Species:Danio rerio


Alignment Length:217 Identity:59/217 - (27%)
Similarity:85/217 - (39%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PPVQTPETPVAK---LVTPPAPAECIKEEEIKPILTPIYVSPV----------ASSASQ----LI 221
            ||...|....:|   ||....|...|.       |.|..|.|.          |||.|:    ..
Zfish    59 PPFTLPRCTFSKLPGLVDARFPLPSIP-------LFPHLVQPAKQESSGPGSGASSKSKPRFDFA 116

  Fly   222 LLSTVAAQQSPTPVPKTPTMSEEKLTT-----------------RITAAQAAATRSRI------- 262
            .|:..|.|..        .:..|.|:|                 ::::.:...:|.|:       
Zfish   117 NLAAAATQDD--------ALKAEDLSTNNGHVRSPSLGCLLDVAKLSSPERKPSRGRLPSKTKKE 173

  Fly   263 YECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSV 327
            :.|.|  ||:::.||.:|..|:|.||.|||:.|  :.|.|.|.|.|.|..|:..|:.||.|:|..
Zfish   174 FVCKF--CGRHFTKSYNLLIHERTHTDERPYTC--DICHKAFRRQDHLRDHRYIHSKEKPFKCQE 234

  Fly   328 CQKKFMRSDHLSKHVKRHNKDK 349
            |.|.|.:|..|:.|...|.:.|
Zfish   235 CGKGFCQSRTLAVHKTLHMQVK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 9/23 (39%)
C2H2 Zn finger 265..287 CDD:275368 9/21 (43%)
COG5048 <270..362 CDD:227381 33/80 (41%)
zf-H2C2_2 279..306 CDD:290200 12/26 (46%)
C2H2 Zn finger 295..317 CDD:275368 8/21 (38%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
osr1NP_001006079.1 zf-C2H2 174..196 CDD:278523 9/23 (39%)
C2H2 Zn finger 176..196 CDD:275368 9/21 (43%)
zf-H2C2_2 188..213 CDD:290200 12/26 (46%)
C2H2 Zn finger 204..224 CDD:275368 8/21 (38%)
zf-H2C2_2 216..239 CDD:290200 9/22 (41%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.