DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and l(3)neo38

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:69/187 - (36%) Gaps:52/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PVPKTPTMSEEKLTTRITAAQAAATRSRIYEC-----SFPD---------------------CGK 272
            |.||...:.|.|          |...|.:|.|     ::||                     |..
  Fly   284 PRPKPGEIRETK----------ALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNA 338

  Fly   273 NYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDH 337
            ...:..||..|:..|..:||.:|  ..|.|.|.|.::|:.|...|:||||..|..|.|.|.|.||
  Fly   339 ALKRKDHLTRHKLSHIPDRPHVC--NICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDH 401

  Fly   338 LSKHVKRHNKDKANGVNRHVSLANNNTSASVAASLCDASLHLRAIAPAGSSASSSPI 394
            |.||.:.|   .|..|...||..|.|.||.....           ...|:||.|:.:
  Fly   402 LRKHTRSH---IARRVKSEVSAQNVNGSAGGGGG-----------GGGGNSAQSNAL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 8/49 (16%)
C2H2 Zn finger 265..287 CDD:275368 7/47 (15%)
COG5048 <270..362 CDD:227381 34/91 (37%)
zf-H2C2_2 279..306 CDD:290200 10/26 (38%)
C2H2 Zn finger 295..317 CDD:275368 7/21 (33%)
zf-H2C2_2 309..332 CDD:290200 10/22 (45%)
zf-C2H2 323..345 CDD:278523 10/21 (48%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 3/19 (16%)
zf-C2H2_8 306..391 CDD:292531 22/86 (26%)
C2H2 Zn finger 333..353 CDD:275368 4/19 (21%)
zf-H2C2_2 345..370 CDD:290200 10/26 (38%)
C2H2 Zn finger 361..381 CDD:275368 7/21 (33%)
zf-H2C2_2 374..398 CDD:290200 11/23 (48%)
C2H2 Zn finger 389..409 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.