DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and CG3065

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:191 Identity:69/191 - (36%)
Similarity:100/191 - (52%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PETPVAKLVTPPAPAECIKEEEIKPILTPIYVSPVASSASQLIL-LSTV-------AAQQSPTPV 235
            |.||..:::|...|.|.:|.....|.::.   :.:...||.:|| .||:       .|.....|.
  Fly     6 PNTPTPQMLTTSTPIEPMKPPPAFPTMSG---ANIHEQASDMILRASTIFEDVKHDEANVENVPH 67

  Fly   236 PKTPTMSEE----------KL----TTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRV 286
            ....|..|:          |:    :.::.|...|:...|.:.|.:.:|.|:|.|||||::|...
  Fly    68 HGVETEPEDDSHYGGNGNSKIRIMPSVKLMATTLASDPKRKFVCPYDNCTKSYGKSSHLRSHLTW 132

  Fly   287 HTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNK 347
            |||.:||:|....|.|.|:|||||:||.|||||||.|:|..|.|||.|||||:||:..|::
  Fly   133 HTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFECIQCTKKFSRSDHLTKHLATHDR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 10/23 (43%)
C2H2 Zn finger 265..287 CDD:275368 10/21 (48%)
COG5048 <270..362 CDD:227381 46/78 (59%)
zf-H2C2_2 279..306 CDD:290200 12/26 (46%)
C2H2 Zn finger 295..317 CDD:275368 12/21 (57%)
zf-H2C2_2 309..332 CDD:290200 15/22 (68%)
zf-C2H2 323..345 CDD:278523 13/21 (62%)
C2H2 Zn finger 325..345 CDD:275368 12/19 (63%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 49/95 (52%)
C2H2 Zn finger 111..133 CDD:275368 10/21 (48%)
zf-C2H2 139..163 CDD:278523 13/23 (57%)
C2H2 Zn finger 141..163 CDD:275368 12/21 (57%)
zf-H2C2_2 155..180 CDD:290200 17/24 (71%)
C2H2 Zn finger 171..191 CDD:275368 12/19 (63%)
zf-C2H2 346..368 CDD:278523
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.