DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cbt and sp5l

DIOPT Version :9

Sequence 1:	NP_722636.1	Gene:	cbt / 33224	FlyBaseID:	FBgn0043364	Length:	428	Species:	Drosophila melanogaster
Sequence 2:	NP_919352.1	Gene:	sp5l / 324261	ZFINID:	ZDB-GENE-030131-2981	Length:	357	Species:	Danio rerio

Alignment Length:	92	Identity:	60/92 - (65%)
Similarity:	68/92 - (73%)	Gaps:	0/92 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   259 RSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKF 323
            :.|::.|..|||||.|.|:||||||.|.|.|||||||.|..|.|.|:|||||.||.|||||||:|
Zfish   246 KKRLHICHIPDCGKVYKKTSHLKAHLRWHAGERPFICNWLFCGKSFTRSDELQRHLRTHTGEKRF 310

  Fly   324 QCSVCQKKFMRSDHLSKHVKRHNKDKA 350
            .|..|.|:||||||||||||.|...|:
Zfish   311 GCQQCGKRFMRSDHLSKHVKTHQSRKS 337

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cbt	NP_722636.1	zf-C2H2	263..287	CDD:278523	15/23 (65%)
		C2H2 Zn finger	265..287	CDD:275368	15/21 (71%)
		COG5048	<270..362	CDD:227381	56/81 (69%)
		zf-H2C2_2	279..306	CDD:290200	18/26 (69%)
		C2H2 Zn finger	295..317	CDD:275368	13/21 (62%)
		zf-H2C2_2	309..332	CDD:290200	15/22 (68%)
		zf-C2H2	323..345	CDD:278523	16/21 (76%)
		C2H2 Zn finger	325..345	CDD:275368	15/19 (79%)
sp5l	NP_919352.1	C2H2 Zn finger	255..274	CDD:275368	14/18 (78%)
		zf-C2H2	280..304	CDD:278523	15/23 (65%)
		C2H2 Zn finger	282..304	CDD:275368	13/21 (62%)
		zf-H2C2_2	296..319	CDD:290200	15/22 (68%)
		C2H2 Zn finger	312..332	CDD:275368	15/19 (79%)
		zf-C2H2	312..332	CDD:278523	15/19 (79%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	3.010