Sequence 1: | NP_722636.1 | Gene: | cbt / 33224 | FlyBaseID: | FBgn0043364 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259388.1 | Gene: | Sp1 / 31913 | FlyBaseID: | FBgn0020378 | Length: | 726 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 90/221 - (40%) |
---|---|---|---|
Similarity: | 116/221 - (52%) | Gaps: | 34/221 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 SPVASSASQLILLSTVAAQQSPTP---VPKTPT-MSEEKLTTRITA-------------AQAAAT 258
Fly 259 RSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKF 323
Fly 324 QCSVCQKKFMRSDHLSKHVKRHN---KDKANGVNRHVSLANNN--TSASVAASLCDASLHLRAI- 382
Fly 383 -------APAGSSASSSPISSASLQV 401 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cbt | NP_722636.1 | zf-C2H2 | 263..287 | CDD:278523 | 14/23 (61%) |
C2H2 Zn finger | 265..287 | CDD:275368 | 14/21 (67%) | ||
COG5048 | <270..362 | CDD:227381 | 61/94 (65%) | ||
zf-H2C2_2 | 279..306 | CDD:290200 | 19/26 (73%) | ||
C2H2 Zn finger | 295..317 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 309..332 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 323..345 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 15/19 (79%) | ||
Sp1 | NP_001259388.1 | C2H2 Zn finger | 390..409 | CDD:275368 | 13/18 (72%) |
zf-H2C2_2 | 401..428 | CDD:290200 | 19/26 (73%) | ||
C2H2 Zn finger | 417..439 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 431..454 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 445..467 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 15/19 (79%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45445298 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23235 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |