DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and Sp1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster


Alignment Length:221 Identity:90/221 - (40%)
Similarity:116/221 - (52%) Gaps:34/221 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SPVASSASQLILLSTVAAQQSPTP---VPKTPT-MSEEKLTTRITA-------------AQAAAT 258
            ||.|::|:    .:|.||....:|   .|.||: .|:.:...|.|.             |.....
  Fly   320 SPSAAAAA----AATAAAAAGGSPQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVHLR 380

  Fly   259 RSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKF 323
            :..|:.|..|.|||.|.|:||||||.|.|||||||:|.|..|.|||:|||||.||.|||||||:|
  Fly   381 KKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRF 445

  Fly   324 QCSVCQKKFMRSDHLSKHVKRHN---KDKANGVNRHVSLANNN--TSASVAASLCDASLHLRAI- 382
            .|.||.|:|||||||:||||.||   ..:|||.|..:...::.  :.:..||:....|..|..: 
  Fly   446 ACPVCNKRFMRSDHLAKHVKTHNGTANHQANGHNGGLKKGSSESCSDSEEAANQSGESNGLGGVG 510

  Fly   383 -------APAGSSASSSPISSASLQV 401
                   |..|...|||...:.:|.|
  Fly   511 SGPQTGGAGGGGGGSSSGNGAGTLAV 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 14/23 (61%)
C2H2 Zn finger 265..287 CDD:275368 14/21 (67%)
COG5048 <270..362 CDD:227381 61/94 (65%)
zf-H2C2_2 279..306 CDD:290200 19/26 (73%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 16/22 (73%)
zf-C2H2 323..345 CDD:278523 16/21 (76%)
C2H2 Zn finger 325..345 CDD:275368 15/19 (79%)
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 13/18 (72%)
zf-H2C2_2 401..428 CDD:290200 19/26 (73%)
C2H2 Zn finger 417..439 CDD:275368 14/21 (67%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 16/21 (76%)
C2H2 Zn finger 447..467 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.