DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and btd

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster


Alignment Length:473 Identity:111/473 - (23%)
Similarity:153/473 - (32%) Gaps:211/473 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SSGAVSSSSQDENSSSSTSCCSSSSNTNTSTSSVPPTVEDDYPEANVWRNLKFKMNRKRAAEVAL 173
            |:.|:.|:....:.|||    .|||.::......|..:|..||:|:             :...|.
  Fly    94 SAAALLSAPPSLSGSSS----GSSSGSSPLYGKPPMKLELPYPQAS-------------STGTAS 141

  Fly   174 PPVQTPETPVAKLVTP---PAPAECIKEEEIKPILTPIYVSPVASSASQLILLSTVAAQQSPTPV 235
            |.......|.:..|:|   |:||:........|......::|..::|         |...:.:|.
  Fly   142 PNSSIQSAPSSASVSPSIFPSPAQSFASISASPSTPTTTLAPPTTAA---------AGALAGSPT 197

  Fly   236 PKTPTMSEEKLTTRITAAQAAAT------------------------------------------ 258
            ..:|:.|.........||.|||.                                          
  Fly   198 SSSPSSSAASAAAAAAAAAAAAADLGAAAVASAAYGWNTAYSGLGPARSQFPYAQYASDYYGNAV 262

  Fly   259 -----------RSRIYE------------------------------------------------ 264
                       :.|:|:                                                
  Fly   263 GMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQRRSVRCTCPNCTNEMSGLPPIVGPDE 327

  Fly   265 -------CSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKK 322
                   |..|.|.:.|.|:||||.|.|.|||||||:|.  .|.|||||||||.||.||||..:.
  Fly   328 RGRKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLCL--TCGKRFSRSDELQRHGRTHTNYRP 390

  Fly   323 FQCSVCQKKFMRSDHLSKHVKRHNKDKAN------------------------------------ 351
            :.|.:|.|||.||||||||.|.|.|||.:                                    
  Fly   391 YACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAAAAIKLEKKEKKSGKPLTPPVEFK 455

  Fly   352 ----------------GVNRHVSLANNN-----------------TSASVAASLCD---ASLHLR 380
                            .:.:|.:.|.::                 |::|.|||..:   :|...|
  Fly   456 QEQPDTTPLVNYAPYANLYQHSTSAGSSVNPPPPPPPLFQQQMTTTTSSAAASFVEQPWSSSSSR 520

  Fly   381 AIAPAGSSASSSPISSAS 398
            ||.||.:|||||..||||
  Fly   521 AIQPATTSASSSSSSSAS 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 12/78 (15%)
C2H2 Zn finger 265..287 CDD:275368 11/21 (52%)
COG5048 <270..362 CDD:227381 53/143 (37%)
zf-H2C2_2 279..306 CDD:290200 17/26 (65%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 11/22 (50%)
zf-C2H2 323..345 CDD:278523 14/21 (67%)
C2H2 Zn finger 325..345 CDD:275368 14/19 (74%)
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 10/18 (56%)
zf-H2C2_2 349..374 CDD:290200 17/26 (65%)
C2H2 Zn finger 365..385 CDD:275368 14/21 (67%)
zf-H2C2_2 377..402 CDD:290200 13/24 (54%)
zf-C2H2 391..413 CDD:278523 14/21 (67%)
C2H2 Zn finger 393..413 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.