DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and KLF15

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_011511045.1 Gene:KLF15 / 28999 HGNCID:14536 Length:435 Species:Homo sapiens


Alignment Length:346 Identity:104/346 - (30%)
Similarity:145/346 - (41%) Gaps:105/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PEIAV--PNKKPRLEQPAMSMTPPPDQKLDDDQKAERVSVIMRVNSSGAV----SSSSQDENSSS 124
            ||..:  |:..||..||.:                |.:...:..|....|    ..:|:|.::.|
Human   142 PEFPLGDPDDVPRPFQPTL----------------EEIEEFLEENMEPGVKEVPEGNSKDLDACS 190

  Fly   125 STSCCSSSSNTNTSTS-----SVP---------------PTVEDDYPEANVWRNLKFKMNRKRAA 169
            ..|.....|:.:..:|     |.|               ||.:...|   |...::....::.:.
Human   191 QLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIP---VLLQIQPVPVKQESG 252

  Fly   170 EVALPPVQTPE-TPVAKL--------------VTPPA----PAECIKEEEIKPILTPIYVSPVAS 215
            .....|.|.|| ..||:|              |.|.:    |::.::   |.|:  ||...||.|
Human   253 TGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVR---IAPV--PIAAKPVGS 312

  Fly   216 SASQLILLSTVAAQQSPTPV--------PKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGK 272
                        ....|.|.        ||.|                ||...::::|:||.|.|
Human   313 ------------GPLGPGPAGLLMGQKFPKNP----------------AAELIKMHKCTFPGCSK 349

  Fly   273 NYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDH 337
            .|.||||||||.|.||||:||.|.|..|..|||||||||||:|:|:|.|.:||.||:|||.||||
Human   350 MYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDH 414

  Fly   338 LSKHVKRHNKDKANGVNRHVS 358
            ||||:|.|...:::...|.|:
Human   415 LSKHIKVHRFPRSSRSVRSVN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 15/23 (65%)
C2H2 Zn finger 265..287 CDD:275368 15/21 (71%)
COG5048 <270..362 CDD:227381 55/89 (62%)
zf-H2C2_2 279..306 CDD:290200 17/26 (65%)
C2H2 Zn finger 295..317 CDD:275368 15/21 (71%)
zf-H2C2_2 309..332 CDD:290200 14/22 (64%)
zf-C2H2 323..345 CDD:278523 16/21 (76%)
C2H2 Zn finger 325..345 CDD:275368 15/19 (79%)
KLF15XP_011511045.1 zf-C2H2 340..364 CDD:278523 15/23 (65%)
zf-C2H2_8 342..421 CDD:292531 54/78 (69%)
C2H2 Zn finger 342..364 CDD:275368 15/21 (71%)
zf-H2C2_2 356..383 CDD:290200 17/26 (65%)
C2H2 Zn finger 372..394 CDD:275368 15/21 (71%)
zf-H2C2_2 386..411 CDD:290200 16/24 (67%)
C2H2 Zn finger 402..422 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.