DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and prz1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:390 Identity:86/390 - (22%)
Similarity:132/390 - (33%) Gaps:127/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AQKSQKNGGI------ITPNPSD---TEDEAPEIAVPNKKPRLE---QPAMSMTPPPDQKLDDDQ 96
            |...:.|.||      ...|||.   :....|.....| .|..|   |.:..:.|...:.|:.:.
pombe   296 ASPGESNTGIDFDTDNTNLNPSVDLLSNHSTPSFIFEN-SPSAEFSHQSSPYLVPNSGRTLNSEN 359

  Fly    97 KAERVSVIMRVNSSGAVSSSSQDENSSSSTS--------CCSSSSNTNTSTSSVPPTVEDDYPEA 153
            ..|  |.|..||     |..|:|...:|.|:        ...|:|..|..:::...|     |:.
pombe   360 ARE--STIRSVN-----SPFSEDHADASLTTHVFDPISPTALSNSVLNYDSNNFSGT-----PQI 412

  Fly   154 NVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEI----KPILTPIYVSPVA 214
            ||                      .|.:|......|..||..:.:.:|    ....:|:...|..
pombe   413 NV----------------------VPSSPSKSQSGPSLPANPLLQTDISITYSQSASPVSGQPAM 455

  Fly   215 SSAS-QLILLSTVAAQQSPT------------------PVPKTPT-------------------- 240
            :..| .|...:..|.:.|||                  |:|:..|                    
pombe   456 NENSYDLQNANLCAPEMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSECLSVNQDTELLGK 520

  Fly   241 ------MSEEKLTTRITAAQAAATRSRI---------------------YECSFPDCGKNYFKSS 278
                  .|.:.|:.|.|..::.:..|.:                     |.|:|..|.|.:.::.
pombe   521 IENDNSKSNDYLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSESKSQGNYVCTFAGCNKRFTRAY 585

  Fly   279 HLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVK 343
            :||:|...||..|||.|  ..|.|.|:|..:..||::.|||.|.|.|..|.::|.|.|.|::|.|
pombe   586 NLKSHMNTHTNYRPFQC--SICKKSFARQHDKRRHEQLHTGIKAFACVTCNQRFARMDALNRHYK 648

  Fly   344  343
            pombe   649  648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 8/23 (35%)
C2H2 Zn finger 265..287 CDD:275368 7/21 (33%)
COG5048 <270..362 CDD:227381 30/74 (41%)
zf-H2C2_2 279..306 CDD:290200 12/26 (46%)
C2H2 Zn finger 295..317 CDD:275368 7/21 (33%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 73/360 (20%)
zf-C2H2 570..594 CDD:278523 8/23 (35%)
C2H2 Zn finger 577..594 CDD:275368 5/16 (31%)
zf-H2C2_2 586..611 CDD:290200 12/26 (46%)
C2H2 Zn finger 602..622 CDD:275368 7/21 (33%)
zf-H2C2_2 616..639 CDD:290200 10/22 (45%)
C2H2 Zn finger 630..648 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.990

Return to query results.
Submit another query.