DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and EGR1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001955.1 Gene:EGR1 / 1958 HGNCID:3238 Length:543 Species:Homo sapiens


Alignment Length:412 Identity:110/412 - (26%)
Similarity:172/412 - (41%) Gaps:100/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TEDEAPEIAVPNKKPRLEQPAMSMT---------------PPPD--QKLDDDQKAERVSVIMRVN 108
            |.:..|:|::.|:|..:|....|.|               |.|:  ..|..:.....||.::.:.
Human   101 TAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMT 165

  Fly   109 SSGAVSSSSQDENSSSST-------SCCSSSSNTNTSTSSVP--PTVEDD-YPEANVWRNLKFKM 163
            :..|.|||:....:||::       ||...|::::...|:.|  ||...| :||.   ::..|..
Human   166 NPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEP---QSQAFPG 227

  Fly   164 NRKRAAEVALPPVQTPETPVAK---------------------LVTP-PAPAECIKEEEIKPILT 206
            :...|.:  .||   |..|.||                     |.|| ..|.:.::....:|.||
Human   228 SAGTALQ--YPP---PAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLT 287

  Fly   207 PIYVSPVASSASQ-----LILLSTVAAQQ--SPTPVPKTPTMSEEKLTTRITAAQAAATRSRIYE 264
            |:  |.:.:.|:|     |..|:|....|  .|:.:.|.|....:           .....|.|.
Human   288 PL--STIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSK-----------TPPHERPYA 339

  Fly   265 CSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQ 329
            |....|.:.:.:|..|..|.|:|||::||.|:  .|.:.|||||.|:.|.|||||||.|.|.:|.
Human   340 CPVESCDRRFSRSDELTRHIRIHTGQKPFQCR--ICMRNFSRSDHLTTHIRTHTGEKPFACDICG 402

  Fly   330 KKFMRSDHLSKHVKRHNKDKANGVNRHVSLANNNTSA-----SVAASLCDASLHLRAIAPA---- 385
            :||.|||...:|.|.|.:.|....::.| :|::.||:     |..|:...:.:.....:||    
Human   403 RKFARSDERKRHTKIHLRQKDKKADKSV-VASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSY 466

  Fly   386 -----------GSSASSSPISS 396
                       |||...||:.|
Human   467 PSPVPTSFSSPGSSTYPSPVHS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 7/23 (30%)
C2H2 Zn finger 265..287 CDD:275368 6/21 (29%)
COG5048 <270..362 CDD:227381 40/91 (44%)
zf-H2C2_2 279..306 CDD:290200 11/26 (42%)
C2H2 Zn finger 295..317 CDD:275368 10/21 (48%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 10/21 (48%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)
EGR1NP_001955.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 1/3 (33%)
DUF3446 135..209 CDD:314753 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..213 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..284 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..339 4/31 (13%)
zf-C2H2 338..362 CDD:306579 7/23 (30%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
zf-H2C2_2 354..379 CDD:316026 11/26 (42%)
C2H2 Zn finger 370..390 CDD:275368 10/21 (48%)
zf-H2C2_2 382..407 CDD:316026 14/24 (58%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..487 18/78 (23%)
DUF3432 447..530 CDD:288743 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.