DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and odd-1

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:276 Identity:62/276 - (22%)
Similarity:103/276 - (37%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SMTPPPDQKLDD-------DQKAERVSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSN---TNT 137
            |..||....::|       .|:...:..:::..|...|:.:|.|..:..::.|.|.||:   :|.
 Worm    11 STVPPVVPSVEDIIRMLVAGQQKIAIQNLLQSQSKEQVNGTSHDLQNWLTSLCISPSSSPTPSNA 75

  Fly   138 STSSVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEEIK 202
            |||::|..:.::    ||..                  :|                  |:.:...
 Worm    76 STSTIPAQMTNE----NVLH------------------LQ------------------IQSQLFS 100

  Fly   203 PILTPIYVSPVASSASQLILLSTVAAQQSPT--PVPKTPTMSEEKLTTRITAAQAAATRSRIYEC 265
            .:.||.:::|               .|.:.|  .:.|.|                    .:.:.|
 Worm   101 NLGTPWFLNP---------------EQHNKTNNAIRKRP--------------------KKEFIC 130

  Fly   266 SFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQK 330
            .:  |.:::.||.:|..|:|.||.||||.|  |.|.|.|.|.|.|..||..|..||..:|.:|.|
 Worm   131 KY--CARHFTKSYNLMIHERTHTNERPFHC--ETCGKSFRRQDHLRDHKYIHAKEKPHKCEICGK 191

  Fly   331 KFMRSDHLSKHVKRHN 346
            .|.:...|:.|...|:
 Worm   192 GFCQLRTLNVHRSCHH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 7/23 (30%)
C2H2 Zn finger 265..287 CDD:275368 7/21 (33%)
COG5048 <270..362 CDD:227381 32/77 (42%)
zf-H2C2_2 279..306 CDD:290200 14/26 (54%)
C2H2 Zn finger 295..317 CDD:275368 10/21 (48%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 7/21 (33%)
zf-H2C2_2 142..167 CDD:290200 14/26 (54%)
C2H2 Zn finger 158..178 CDD:275368 10/21 (48%)
zf-H2C2_2 170..193 CDD:290200 9/22 (41%)
C2H2 Zn finger 186..206 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.