DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and ZNF362

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001357141.1 Gene:ZNF362 / 149076 HGNCID:18079 Length:420 Species:Homo sapiens


Alignment Length:405 Identity:100/405 - (24%)
Similarity:167/405 - (41%) Gaps:95/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSPPATPPLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKNGGIITPNPSDTEDEAPEIAVPN 72
            |.||..|...:|.:.|....||.:.|.:....|...:..||: ..::.|.|:::......:    
Human    26 PPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQ-PLLVPPAPAESSQAVMSL---- 85

  Fly    73 KKPRLEQ-PAM--SMTPPPDQKLDDDQKAERVSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSN 134
              |:|:| |.:  ...|.||..|........|:         .:..|::..:.|:|.|...:.:.
Human    86 --PKLQQVPGLHPQAVPQPDVALHARPATSTVT---------GLGLSTRTPSVSTSESSAGAGTG 139

  Fly   135 TNTSTSSVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIK-- 197
            |.|||.|.|.|.                   .::..:|..|     |.::.:.:||. .:.||  
Human   140 TGTSTPSTPTTT-------------------SQSRLIASSP-----TLISGITSPPL-LDSIKTI 179

  Fly   198 --------------EEEIK---PILTPIYVSPVASSASQLILLSTVAAQQSPT----PVPKT-PT 240
                          .::||   |...|:.|.|..      ||.|...|::..|    ..|.| .|
Human   180 QGHGLLGPPKSERGRKKIKAENPGGPPVLVVPYP------ILASGETAKEGKTYRCKVCPLTFFT 238

  Fly   241 MSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFS 305
            .||.::.::      :.|.::.::|  |.|.|::..:|:|..|.|:|.|.:|:.|.:  |||.|.
Human   239 KSEMQIHSK------SHTEAKPHKC--PHCSKSFANASYLAQHLRIHLGVKPYHCSY--CDKSFR 293

  Fly   306 RSDELSRHKRTHTGEKKFQC--SVCQKKFMRSDHLSKHVKRHNKDKANGVNRHVSLANNNTSASV 368
            :...|.:|.|.|||::.::|  ..|:|.|.:..:|..|.::|||||.      ....|...:.|.
Human   294 QLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKP------YKCPNCYRAYSD 352

  Fly   369 AASLCDASLHLRAIA 383
            :|||   .:||.|.|
Human   353 SASL---QIHLSAHA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 8/23 (35%)
C2H2 Zn finger 265..287 CDD:275368 8/21 (38%)
COG5048 <270..362 CDD:227381 31/93 (33%)
zf-H2C2_2 279..306 CDD:290200 11/26 (42%)
C2H2 Zn finger 295..317 CDD:275368 8/21 (38%)
zf-H2C2_2 309..332 CDD:290200 9/24 (38%)
zf-C2H2 323..345 CDD:278523 6/23 (26%)
C2H2 Zn finger 325..345 CDD:275368 6/21 (29%)
ZNF362NP_001357141.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 1/1 (100%)
PRK14971 <27..>125 CDD:237874 23/113 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..155 12/67 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202 2/23 (9%)
C2H2 Zn finger 229..249 CDD:275368 5/25 (20%)
zf-H2C2_2 241..266 CDD:372612 6/32 (19%)
zf-C2H2 255..277 CDD:333835 8/23 (35%)
C2H2 Zn finger 257..277 CDD:275368 8/21 (38%)
zf-H2C2_2 269..294 CDD:372612 11/26 (42%)
C2H2 Zn finger 285..305 CDD:275368 8/21 (38%)
SFP1 <307..359 CDD:227516 17/60 (28%)
C2H2 Zn finger 313..335 CDD:275368 6/21 (29%)
C2H2 Zn finger 343..363 CDD:275368 7/22 (32%)
C2H2 Zn finger 375..393 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.