DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and Klf9

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_476559.2 Gene:Klf9 / 117560 RGDID:70934 Length:244 Species:Rattus norvegicus


Alignment Length:185 Identity:76/185 - (41%)
Similarity:102/185 - (55%) Gaps:28/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PVQTPETPVAKLVTPP----APAECIKEEEIKPILTPIYVSPVASSASQLILLSTVAAQQSPTPV 235
            |:|||......|.:|.    :.::...|....|..:|.......|:.|.|.||.:..|.      
  Rat    75 PIQTPSVCSDSLESPDEDIGSDSDVTTESGSSPSHSPEERQDSGSAPSPLSLLHSGVAS------ 133

  Fly   236 PKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENC 300
             |....||::                 ::|.:..|||.|.||||||||.|||||||||.|.|.:|
  Rat   134 -KGKHASEKR-----------------HKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC 180

  Fly   301 DKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKANGVNR 355
            .|:|||||||:||.|||||||:|:|.:|:|:|||||||:||.:||.:...:.:.|
  Rat   181 LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 14/23 (61%)
C2H2 Zn finger 265..287 CDD:275368 14/21 (67%)
COG5048 <270..362 CDD:227381 57/86 (66%)
zf-H2C2_2 279..306 CDD:290200 19/26 (73%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 15/22 (68%)
zf-C2H2 323..345 CDD:278523 13/21 (62%)
C2H2 Zn finger 325..345 CDD:275368 12/19 (63%)
Klf9NP_476559.2 KLF9_N 3..144 CDD:409239 18/92 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..51
COG5048 <78..234 CDD:227381 73/179 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..143 15/87 (17%)
C2H2 Zn finger 145..167 CDD:275368 14/21 (67%)
C2H2 Zn finger 175..197 CDD:275368 14/21 (67%)
C2H2 Zn finger 205..225 CDD:275368 12/19 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.