DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and OSR2

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001273770.1 Gene:OSR2 / 116039 HGNCID:15830 Length:433 Species:Homo sapiens


Alignment Length:137 Identity:43/137 - (31%)
Similarity:67/137 - (48%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LSTVAAQQSP---------TPVPKTPTMSEEKLT--TRITAAQAAATRSRIYECSFPDCGKNYFK 276
            |:..|.|:.|         :|...:|.....|||  .:.:..:..:...:.:.|.|  ||:::.|
Human   242 LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKF--CGRHFTK 304

  Fly   277 SSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKH 341
            |.:|..|:|.||.|||:.|  :.|.|.|.|.|.|..|:..|:.||.|:|..|.|.|.:|..|:.|
Human   305 SYNLLIHERTHTDERPYTC--DICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVH 367

  Fly   342 VKRHNKD 348
            ...|.::
Human   368 KTLHMQE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 9/23 (39%)
C2H2 Zn finger 265..287 CDD:275368 9/21 (43%)
COG5048 <270..362 CDD:227381 32/79 (41%)
zf-H2C2_2 279..306 CDD:290200 12/26 (46%)
C2H2 Zn finger 295..317 CDD:275368 8/21 (38%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
OSR2NP_001273770.1 COG5048 <293..428 CDD:227381 34/86 (40%)
C2H2 Zn finger 295..315 CDD:275368 9/21 (43%)
zf-H2C2_2 307..332 CDD:290200 12/26 (46%)
C2H2 Zn finger 323..343 CDD:275368 8/21 (38%)
zf-H2C2_2 335..358 CDD:290200 9/22 (41%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 377..399 CDD:278523
C2H2 Zn finger 379..399 CDD:275368
zf-H2C2_2 391..416 CDD:290200
C2H2 Zn finger 407..427 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.