DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cbt and Osr2

DIOPT Version :9

Sequence 1:	NP_722636.1	Gene:	cbt / 33224	FlyBaseID:	FBgn0043364	Length:	428	Species:	Drosophila melanogaster
Sequence 2:	NP_001355594.1	Gene:	Osr2 / 107587	MGIID:	1930813	Length:	312	Species:	Mus musculus

Alignment Length:	140	Identity:	40/140 - (28%)
Similarity:	67/140 - (47%)	Gaps:	21/140 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   223 LSTVAAQQSP--------------TPVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKN 273
            |:..|.|:.|              :|:.....::.::..:|   .:..:...:.:.|.|  ||::
Mouse   121 LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSR---GRLPSKTKKEFICKF--CGRH 180

  Fly   274 YFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHL 338
            :.||.:|..|:|.||.|||:.|  :.|.|.|.|.|.|..|:..|:.||.|:|..|.|.|.:|..|
Mouse   181 FTKSYNLLIHERTHTDERPYTC--DICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTL 243

  Fly   339 SKHVKRHNKD 348
            :.|...|.::
Mouse   244 AVHKTLHMQE 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cbt	NP_722636.1	zf-C2H2	263..287	CDD:278523	9/23 (39%)
		C2H2 Zn finger	265..287	CDD:275368	9/21 (43%)
		COG5048	<270..362	CDD:227381	32/79 (41%)
		zf-H2C2_2	279..306	CDD:290200	12/26 (46%)
		C2H2 Zn finger	295..317	CDD:275368	8/21 (38%)
		zf-H2C2_2	309..332	CDD:290200	9/22 (41%)
		zf-C2H2	323..345	CDD:278523	8/21 (38%)
		C2H2 Zn finger	325..345	CDD:275368	7/19 (37%)
Osr2	NP_001355594.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	146..165		2/21 (10%)
		C2H2 Zn finger	174..194	CDD:275368	9/21 (43%)
		zf-H2C2_2	186..211	CDD:338759	12/26 (46%)
		C2H2 Zn finger	202..222	CDD:275368	8/21 (38%)
		zf-H2C2_2	214..237	CDD:338759	9/22 (41%)
		C2H2 Zn finger	230..250	CDD:275368	7/19 (37%)
		COG5048	251..>312	CDD:227381	0/3 (0%)
		C2H2 Zn finger	258..278	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030