DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbt and KLF2

DIOPT Version :9

Sequence 1:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_057354.1 Gene:KLF2 / 10365 HGNCID:6347 Length:355 Species:Homo sapiens


Alignment Length:160 Identity:67/160 - (41%)
Similarity:92/160 - (57%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PPAPAECIKEEEIKPILTPIY-VSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRITA 252
            ||||              |.: :...|::|:..:.|:..||:...|| |.:|.   |.|..:...
Human   213 PPAP--------------PAFGLFDDAAAAAAALGLAPPAARGLLTP-PASPL---ELLEAKPKR 259

  Fly   253 AQAAATRSR--IYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKR 315
            .:.:..|.|  .:.||:..|||.|.||||||||.|.||||:|:.|.|:.|..:|:|||||:||.|
Human   260 GRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYR 324

  Fly   316 THTGEKKFQCSVCQKKFMRSDHLSKHVKRH 345
            .|||.:.|||.:|.:.|.|||||:.|:|||
Human   325 KHTGHRPFQCHLCDRAFSRSDHLALHMKRH 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 15/23 (65%)
C2H2 Zn finger 265..287 CDD:275368 15/21 (71%)
COG5048 <270..362 CDD:227381 47/76 (62%)
zf-H2C2_2 279..306 CDD:290200 15/26 (58%)
C2H2 Zn finger 295..317 CDD:275368 12/21 (57%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 12/21 (57%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)
KLF2NP_057354.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 43..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..90
Interaction with WWP1. /evidence=ECO:0000250 111..268 17/72 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..209
COG5048 <267..350 CDD:227381 46/82 (56%)
zf-C2H2 272..296 CDD:278523 15/23 (65%)
C2H2 Zn finger 274..296 CDD:275368 15/21 (71%)
zf-H2C2_2 288..>310 CDD:290200 13/21 (62%)
C2H2 Zn finger 304..326 CDD:275368 12/21 (57%)
zf-H2C2_2 318..343 CDD:290200 13/24 (54%)
C2H2 Zn finger 334..354 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.