DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4133 and AT5G63280

DIOPT Version :9

Sequence 1:NP_608526.1 Gene:CG4133 / 33221 FlyBaseID:FBgn0031257 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_568969.1 Gene:AT5G63280 / 836448 AraportID:AT5G63280 Length:271 Species:Arabidopsis thaliana


Alignment Length:221 Identity:57/221 - (25%)
Similarity:85/221 - (38%) Gaps:45/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TNVIRILCSRDNSRLVRKIVRSKWTPILDKHQVKLPLECPLHPFRDVFAPRQDAKQRDRPTQWTC 88
            :|...|.|||:.||...:|::...||.:::.:.::|..|.|||..|::..::..|......:|.|
plant    43 SNAPEIHCSRERSRAAWQIIQDYLTPFVERERYEIPKNCRLHPDNDLYRDQEHHKVHVDVFEWKC 107

  Fly    89 RKCGKSFYQEKHLDLHFDTRHKSIINEAEDAVCLADFCDIMRCEVFETEDASSLKFGDQHIVTDI 153
            ..|.|||..||.||.||.|||.:::| ..|..||||.|..:.|:..                   
plant   108 GYCKKSFNDEKFLDKHFSTRHYNLLN-TTDTKCLADLCGALHCDFV------------------- 152

  Fly   154 EVWGDSLGQNSALAKANAAYLSLIPRTSTLGASRAAKVQNRQLLQDKPSQASKQNQSPAGERTHP 218
                  |......:|.|.                .|..:||.|.:...:.....:|.|:..|.|.
plant   153 ------LSSKKPKSKCNP----------------PAVAKNRHLCESVANSCFPVSQGPSASRLHE 195

  Fly   219 QSHHHPRDRASTTANPLRLDPSPEDG 244
            .......|..:.|.|.   .|.|..|
plant   196 HFLRQFCDAHTCTGND---KPFPRGG 218



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JBI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1494478at2759
OrthoFinder 1 1.000 - - FOG0014336
OrthoInspector 1 1.000 - - otm3467
orthoMCL 1 0.900 - - OOG6_109709
Panther 1 1.100 - - LDO PTHR21385
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.