DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and APJ1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:430 Identity:107/430 - (24%)
Similarity:170/430 - (39%) Gaps:125/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDRCG- 90
            |..|||...|:|:|:|||||..|.:.|||||....::..|||::..|||:|.:...|..||:.| 
Yeast     8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYDQYGT 72

  Fly    91 -EECLKKEGMMD-------------------------HGGDPFSSFF------------GDFGFH 117
             :|.|.:|....                         ..||.|:.||            ..|.|.
Yeast    73 TDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGSKSSFNFS 137

  Fly   118 F-----------GGDG---------------QQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNK 156
            |           .|.|               :.....||.||..:|..:|:|||.|...::..|:
Yeast   138 FNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLKCTLKELYMGKTAKLGLNR 202

  Fly   157 ----PVTKPASGTRKCNCRQ------EMVTRNLGPGRFQMIQQT---------------VCDECP 196
                .|.....|.:||.|:.      :..||.:|| ..|...||               :|.:|.
Yeast   203 TRICSVCDGHGGLKKCTCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVKNKDICQQCQ 266

  Fly   197 NVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGE--------PGDLIVRVQQMPHPRFLRK 253
            .:..:.|.:.|::.|:.|....|......||:..|..:        |||:::.:.::..|.|...
Yeast   267 GLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVI 331

  Fly   254 NDDLYTNV-----TISLQDALVGFSMEIKHLDGH---------LVPVTREKVTWPGARIRKKGEG 304
            |   |:|:     .|....:|.|   .:.:::||         ::|   .::..||.....:..|
Yeast   332 N---YSNLICKKCKIDFMTSLCG---GVVYIEGHPSGKLIKLDIIP---GEILKPGCFKTVEDMG 387

  Fly   305 MPNFENNNLT--GNLYITFDVEFPKKDLTEEDKEALKKIL 342
            ||.|.|...:  |:||:.|||.:|:: |..|:.:.::.||
Yeast   388 MPKFINGVRSGFGHLYVKFDVTYPER-LEPENAKKIQNIL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 107/430 (25%)
DnaJ 25..87 CDD:278647 26/59 (44%)
DnaJ_C 131..328 CDD:199909 59/245 (24%)
DnaJ_zf 160..>195 CDD:304418 12/55 (22%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 107/430 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.