DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and HLJ1

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:53/145 - (36%)
Similarity:71/145 - (48%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IQLSLLLVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAY 74
            |.|.:|..::    .:||:||.|.:.|..:|:|||||:||.:|||||| ..|.|...|:.:..|:
Yeast    10 IALEILSKDK----HEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKN-SHPKAGEAFKVINRAF 69

  Fly    75 EVLSNPDKRKTYDRCG----EECLKKEGMM-----DHGGDPFSSFFGD--FGFHFGGD--GQQQD 126
            |||||.:||..|||.|    :..:...|..     ..||.|....|.|  |...|||.  |..:|
Yeast    70 EVLSNEEKRSIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQRAGPPED 134

  Fly   127 ----------APRGA 131
                      :|.||
Yeast   135 IFDFLFNAGGSPFGA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 50/130 (38%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 50/129 (39%)

Return to query results.
Submit another query.