DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and XDJ1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_013191.1 Gene:XDJ1 / 850779 SGDID:S000004080 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:104/400 - (26%)
Similarity:172/400 - (43%) Gaps:83/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDAST---KFQDLGAAYEVLSNPDKRK 84
            |...|.:|.|.::|...|:|.|||:||.:.||||..|......   ||:::.||||:||:|:|:.
Yeast     7 GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKS 71

  Fly    85 TYDRCGEE--CLKKEGMMDHGGDPFSSFFGDF-------GFHFGGD---GQQQDAPRGADIVMDL 137
            .||..|::  .....|....|.:.|.:||.:|       |.:|.|:   .::.::....||.:|:
Yeast    72 HYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSSKDIDIDI 136

  Fly   138 YVSLEELYSGNFVEIVRNKPVT---------KP----------------ASGTR----------- 166
            .::|::||.|..::....:.|.         ||                ..|::           
Yeast   137 SLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLV 201

  Fly   167 --------KCNCRQEMVTRNLGPGRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRF 223
                    |||.:.:...|...|..|       |.:|..:.|::::..:.:.|..|.........
Yeast   202 ASQWVVCEKCNGKGKYTKRPKNPKNF-------CPDCAGLGLLSKKEIITVNVAPGHHFNDVITV 259

  Fly   224 VAEGEPHIDGEP-GD----LIVRVQQMPHPRFLRKN------DDLYTNVTISLQDALVGFSMEI- 276
            ....:..||... ||    |..:.:.:...:...||      :||||::||||.:||.||...: 
Yeast   260 KGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLT 324

  Fly   277 KHLDGHLVPVTRE--KVTWPGARIRKKGEGMPNFEN-NNLTGNLYITFDVEFPKKDLTEEDKE-- 336
            |..|..|:.::.:  :|..||..|:...||.|..:| :...|:||:...:|||..:...|..|  
Yeast   325 KTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFNEKSELL 389

  Fly   337 ALKKILDQSS 346
            |:|..|..||
Yeast   390 AIKTNLPSSS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 102/398 (26%)
DnaJ 25..87 CDD:278647 26/64 (41%)
DnaJ_C 131..328 CDD:199909 58/255 (23%)
DnaJ_zf 160..>195 CDD:304418 10/69 (14%)
XDJ1NP_013191.1 DnaJ 11..379 CDD:223560 96/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2491
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.