DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and MDJ1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_116638.1 Gene:MDJ1 / 850530 SGDID:S000001878 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:462 Identity:117/462 - (25%)
Similarity:179/462 - (38%) Gaps:144/462 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPD 81
            :..:.|.:|.|..|.:||:|...|:||||.:|||:.|||.|| :|||..||.||..|||:||:..
Yeast    53 IRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINK-EPDAEKKFHDLQNAYEILSDET 116

  Fly    82 KRKTYDRCGEECL----KKEGMMDHGGDPFSSFFGD--------------------FGFHFGGDG 122
            ||:.||:.|....    ...|.....|.||.|.|.|                    ||..|||.|
Yeast   117 KRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAAFGGGG 181

  Fly   123 Q-QQDAPRGADIVMDLYVSLEELYSGNFVEIVR----------NKPV-----------------T 159
            : ...|.|.:        |:...|.|:.:|||.          :|.|                 .
Yeast   182 RGSGGASRSS--------SMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGM 238

  Fly   160 KPASGTRKCN-CRQEMVTRNLGPGRFQMIQ--------------QTVCDECPNVKL-VNEERTLE 208
            ||.:....|: |.....|.:: .|.|||:.              |..|.:|....: ||..:|:.
Yeast   239 KPNTHKVSCSTCHGTGTTVHI-RGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKTIT 302

  Fly   209 IEVEQGMVDGQETRFVAEGE-PHIDGEP----------GDLIVRVQQMPHPRFLRKND-DLYTNV 261
            :::..|:.||...|...:|. |.|..|.          ||::||::....|.|..||. |::.:.
Yeast   303 VDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDK 367

  Fly   262 TISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGAR----IRKKGEGMPNFENNNLTGNLYITFD 322
            .|.:..|.:|.::.|..::|..:   |.||. ||.:    |.....|:|  :.:.:.|::.:.:.
Yeast   368 EIPITTAALGGTVTIPTVEGQKI---RIKVA-PGTQYNQVISIPNMGVP--KTSTIRGDMKVQYK 426

  Fly   323 V------------------------------------------EFPKKDLTEEDKEALKKILDQS 345
            :                                          |..||...||:|.|.|.  |.:
Yeast   427 IVVKKPQSLAEKCLWEALADVTNDDMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKD--DDN 489

  Fly   346 SINRIYN 352
            ::.|:.|
Yeast   490 TLKRLEN 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 115/449 (26%)
DnaJ 25..87 CDD:278647 33/61 (54%)
DnaJ_C 131..328 CDD:199909 55/297 (19%)
DnaJ_zf 160..>195 CDD:304418 11/49 (22%)
MDJ1NP_116638.1 DnaJ 60..456 CDD:223560 105/411 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.