DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Samd13

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_083420.2 Gene:Samd13 / 75015 MGIID:2686498 Length:234 Species:Mus musculus


Alignment Length:228 Identity:54/228 - (23%)
Similarity:96/228 - (42%) Gaps:70/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDAS-TKFQDLGAAYEVLSNPDKRKTYDR 88
            ::||:|.|.:||:::::|:|:.:||.::|||||..|.:|: .||:.:..||.:||:..|||.|||
Mouse     3 NYYKVLGVPRNASSSDIKRAFHQLALQVHPDKNPGDKEAAEEKFKQVAEAYHILSDAKKRKDYDR 67

  Fly    89 C------GE---------ECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLY 138
            .      ||         |.::.....|.                 .|.:::...|.........
Mouse    68 SRWNRNKGEIRGDGHDKGETIRVNDSRDE-----------------TDWEEKICSRRPRHTFQKV 115

  Fly   139 VSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTR-------------------------- 177
            ...|:|:||:.:       .:.|.:|:|:.:.....||.                          
Mouse   116 TEDEDLFSGDCL-------FSGPITGSRRASSPFFTVTPIMDTGFSTFVSHESRSYSDDPETFVP 173

  Fly   178 --NLGPGRFQMIQQTVCDECPNVKLVNEERTLE 208
              :.|.|:|:::  |.|.:..|.|.|..:|.:|
Mouse   174 YISQGMGKFRLV--TTCSKTVNGKRVVTKRVVE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 54/228 (24%)
DnaJ 25..87 CDD:278647 26/62 (42%)
DnaJ_C 131..328 CDD:199909 19/106 (18%)
DnaJ_zf 160..>195 CDD:304418 10/62 (16%)
Samd13NP_083420.2 DnaJ 2..>67 CDD:223560 27/63 (43%)
DnaJ 3..66 CDD:278647 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.