DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb13

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_705755.2 Gene:Dnajb13 / 69387 MGIID:1916637 Length:316 Species:Mus musculus


Alignment Length:353 Identity:114/353 - (32%)
Similarity:169/353 - (47%) Gaps:73/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |.|:|.:|.|.:|:...::|||||:||.:.||.|: .:|.|...|:.:..||:|||:|.||..||
Mouse     2 GLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKS-SEPGAPEIFKQIAEAYDVLSDPVKRGIYD 65

  Fly    88 RCGEECLK-------------KEGMMDH-----------GGD-PFSSFF----GDFGFHFGG--- 120
            :.|||.||             ..|.:.|           ||| |||.||    .|...:|||   
Mouse    66 KFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWG 130

  Fly   121 -DGQQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPGRF 184
             ..|:||.|    |..|||:|||:|:.|                    |..:.::..|.|...|:
Mouse   131 RGVQKQDPP----IERDLYLSLEDLFFG--------------------CTKKIKISRRVLNEDRY 171

  Fly   185 QMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMPHPR 249
               ..|:           :::.|.|:|..|...|....|..||:...:..|.|:|..|::..|||
Mouse   172 ---SSTI-----------KDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPR 222

  Fly   250 FLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIRKKGEGMPNFENNNLT 314
            |.|::|:|:....|.|..||...::|:|.||..|:.:....:..|.......|||||..||.:..
Mouse   223 FRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKK 287

  Fly   315 GNLYITFDVEFPKKDLTEEDKEALKKIL 342
            |:|:|.||::||.: ||.:.|:.|::.|
Mouse   288 GDLFIFFDIQFPTR-LTPQKKQMLRQAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 114/353 (32%)
DnaJ 25..87 CDD:278647 26/61 (43%)
DnaJ_C 131..328 CDD:199909 57/196 (29%)
DnaJ_zf 160..>195 CDD:304418 5/34 (15%)
Dnajb13NP_705755.2 DnaJ 1..312 CDD:223560 113/349 (32%)
DnaJ 4..65 CDD:278647 26/61 (43%)
DnaJ_C 138..302 CDD:199909 58/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.