DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb7

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001123982.1 Gene:Dnajb7 / 685839 RGDID:1589047 Length:303 Species:Rattus norvegicus


Alignment Length:242 Identity:67/242 - (27%)
Similarity:103/242 - (42%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDD-PDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            |:|::|.|::.|:..::|:|||::|.:.|||||.:: .:|..||:::..|||||||.:||..||:
  Rat     3 DYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGEKRDIYDK 67

  Fly    89 CGEECLKKEGMMDHGG-----------------DPFSSFFGD---FGFHFGGDGQQQDAPRGADI 133
            .|     |||:...||                 |.|...||:   |.|||..|..       ||:
  Rat    68 YG-----KEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSFHFFEDSL-------ADL 120

  Fly   134 VMDLYVSLEELYSGNFVEIVRNKPVTKPAS------------GTRKCNCRQEMVTRNLGPGRFQM 186
            :.....|......|:......:.||....|            |.........:...:.|.|.:..
  Rat   121 LSSSRSSSGSRSRGSLFSRSYDYPVFARLSSYDTGYSPYVSRGHESLTSVSSLAFEDPGVGNYIP 185

  Fly   187 IQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETR-FVAEGEPHID 232
            |..:|.    |.:.|..::|.|...|:.:.|..|.| |:...|...|
  Rat   186 ITPSVI----NGRNVKTKKTFENRQERKVEDDSELRSFLVNEEGFAD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 67/242 (28%)
DnaJ 25..87 CDD:278647 27/62 (44%)
DnaJ_C 131..328 CDD:199909 23/115 (20%)
DnaJ_zf 160..>195 CDD:304418 6/46 (13%)
Dnajb7NP_001123982.1 DnaJ 3..66 CDD:278647 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.