DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb4

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001343292.1 Gene:Dnajb4 / 67035 MGIID:1914285 Length:337 Species:Mus musculus


Alignment Length:377 Identity:121/377 - (32%)
Similarity:175/377 - (46%) Gaps:95/377 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|.||.:.|.|...:||||||:.|.:.|||||| .|.|..||:::..||||||:|.||:.||
Mouse     2 GKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNK-SPQAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    88 RCGEECLK--KEGMMDHG--------GDP---FSSFFGD-------FGFHFGG---------DGQ 123
            :.|||.||  ..|....|        |||   |::|||.       ||...||         ||.
Mouse    66 QFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGD 130

  Fly   124 ------------------------QQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASG 164
                                    :||.|    |:.:|.|||||:|||                 
Mouse   131 PFSAFGFSMNGYPRDRNSVGPSRLKQDPP----IIHELKVSLEEIYSG----------------- 174

  Fly   165 TRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGE 228
               |..|.::..:.|.| ||               ...:|::.|.||:::|..:|.:..|..||:
Mouse   175 ---CTKRMKISRKRLNPDGR---------------SYRSEDKILTIEIKKGWKEGTKITFPREGD 221

  Fly   229 PHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTW 293
            ...:..|.|::..::...||:|.|...::.....|||::||.|.|:.:..:||..:|::...:..
Mouse   222 ETPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVK 286

  Fly   294 PGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKILDQS 345
            ||.|.|..|.|:|..:|.:..|:|.|.|||.||.. ::...||.|:|.|..|
Mouse   287 PGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDV-ISAASKEILRKHLPAS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 121/377 (32%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 57/197 (29%)
DnaJ_zf 160..>195 CDD:304418 6/35 (17%)
Dnajb4NP_001343292.1 DnaJ 1..332 CDD:223560 118/370 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.