DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnaja4

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001344804.1 Gene:Dnaja4 / 58233 MGIID:1927638 Length:426 Species:Mus musculus


Alignment Length:364 Identity:131/364 - (35%)
Similarity:187/364 - (51%) Gaps:59/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNP 80
            :|:|:    .:|.||.||.:|:..|:|||||:||.:.|||||   ||...||:.:..||||||:|
Mouse    30 MVKET----QYYDILGVKPSASPEEIKKAYRKLALKYHPDKN---PDEGEKFKLISQAYEVLSDP 87

  Fly    81 DKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEELY 145
            .||..||:.||:.:|:.|   .|...|||....|...|||.|:.....||.::|..|.|:||:||
Mouse    88 KKRDIYDQGGEQAIKEGG---SGSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLY 149

  Fly   146 SGNFVEIVRNKPVT---------KPASGTRKCN-CR---QEMVTRNLGPGRFQMIQQTVC----- 192
            :|...::...|.|.         |..| ..||. |:   .::..:.:|||..|.| ||||     
Mouse   150 NGITKKLALQKNVICEKCEGIGGKKGS-VEKCPLCKGRGMQVHIQQIGPGMVQQI-QTVCIECKG 212

  Fly   193 --------DECPN---VKLVNEERTLEIEVEQGMVDGQETRFVAEG--EPHIDGEPGDLIVRVQQ 244
                    |.|.|   .|:..|::.:|:.||:||.|||:..|..||  ||.:|  |||:|:.:.|
Mouse   213 QGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHGEGDQEPELD--PGDVIIVLDQ 275

  Fly   245 MPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIRK------KGE 303
            ..|..|.|:..||...:.|.|.:||.||...||.||..::.::.:.    |..|:.      :.|
Mouse   276 KDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLVISSKS----GEVIKHGDLKCIRNE 336

  Fly   304 GMPNFENNNLTGNLYITFDVEFPKKDLTEEDK----EAL 338
            |||.::.....|.:.|.|.|.||:|....::|    |||
Mouse   337 GMPIYKAPLEKGVMIIQFLVVFPEKQWLSQEKLPQLEAL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 129/358 (36%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 75/233 (32%)
DnaJ_zf 160..>195 CDD:304418 15/51 (29%)
Dnaja4NP_001344804.1 DnaJ 15..423 CDD:333066 131/364 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.