DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment shv and dnajc3b

DIOPT Version :9

Sequence 1:	NP_608525.1	Gene:	shv / 33220	FlyBaseID:	FBgn0031256	Length:	354	Species:	Drosophila melanogaster
Sequence 2:	NP_571705.1	Gene:	dnajc3b / 58154	ZFINID:	ZDB-GENE-000831-4	Length:	502	Species:	Danio rerio

Alignment Length:	108	Identity:	43/108 - (39%)
Similarity:	61/108 - (56%)	Gaps:	16/108 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPD---KNKDDPDASTKFQDLGAAYEVLSNPDKRKT 85
            ||:||||.|.::||..|:.||||:||::.|||   ...|..:|..||.|:.:|.|||::|:.|:.
Zfish   395 RDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIASAKEVLTDPEMRQK 459

  Fly    86 YDRCGEECLKKEGMMDHGG----------DPFSSFFGDFGFHF 118
            :| .||:.|..|.....||          :||..  |:|.|.|
Zfish   460 FD-SGEDPLDPENQQGGGGGGPREWPFGFNPFEG--GNFHFKF 499

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
shv	NP_608525.1	DnaJ	22..346	CDD:223560	43/108 (40%)
		DnaJ	25..87	CDD:278647	29/64 (45%)
		DnaJ_C	131..328	CDD:199909
		DnaJ_zf	160..>195	CDD:304418
dnajc3b	NP_571705.1	TPR_11	41..107	CDD:290150
		TPR repeat	42..70	CDD:276809
		TPR repeat	75..105	CDD:276809
		TPR_11	77..141	CDD:290150
		TPR repeat	110..137	CDD:276809
		TPR repeat	157..184	CDD:276809
		TPR_11	189..254	CDD:290150
		TPR repeat	190..218	CDD:276809
		TPR repeat	223..253	CDD:276809
		TPR repeat	303..337	CDD:276809
		TPR repeat	342..370	CDD:276809
		TPR	348..375	CDD:197478
		DnaJ	394..>500	CDD:223560	43/108 (40%)
		DnaJ	396..461	CDD:278647	29/64 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910