DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb7

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_067292.2 Gene:Dnajb7 / 57755 MGIID:1914012 Length:312 Species:Mus musculus


Alignment Length:277 Identity:72/277 - (25%)
Similarity:105/277 - (37%) Gaps:103/277 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDD-PDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            |:|::|.|::.|:..::|:|||::|.:.|||||.:: .:|..||:::..|||||||.:||..||:
Mouse     3 DYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNVEKRDIYDK 67

  Fly    89 CGEECLKKEGM--MD----------HGGDPFSSFFGD---FGFHFGGDG-----QQQDAPRGA-- 131
            .|:|.|...|.  :|          ...|.|...||:   |.||...|.     ....:|.|:  
Mouse    68 YGKEGLDGRGASHLDDEREYRFTFRKADDVFKEIFGERDPFSFHLFEDSLEGLLNSSRSPSGSRG 132

  Fly   132 ----------------------DIVMDLYVSL--EELYS-----------GNFVEIVRNKPV--- 158
                                  |.....||||  |.|.|           ||::.|..:..|   
Mouse   133 RGAGSHVSRAYDHPALSGLSSYDTGYSSYVSLGHEGLTSFSSLALDDSGMGNYIPITPSGKVING 197

  Fly   159 ----TKPASGTR---------------------------KCNCRQEMVTRNLGPGRF---QMIQQ 189
                ||.|...|                           |||.|::.. .|..|..:   ...|.
Mouse   198 RNINTKKAFENRQEREAEDDSELISFLVNSVANEEHFTDKCNWRRQSF-NNYSPNSYSSSNTTQY 261

  Fly   190 TVCDECPNVKLVNEERT 206
            |:.|.       ||:.|
Mouse   262 TLVDN-------NEQGT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 72/277 (26%)
DnaJ 25..87 CDD:278647 27/62 (44%)
DnaJ_C 131..328 CDD:199909 28/150 (19%)
DnaJ_zf 160..>195 CDD:304418 12/64 (19%)
Dnajb7NP_067292.2 DnaJ 3..66 CDD:278647 27/62 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..312 72/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.