Sequence 1: | NP_608525.1 | Gene: | shv / 33220 | FlyBaseID: | FBgn0031256 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067292.2 | Gene: | Dnajb7 / 57755 | MGIID: | 1914012 | Length: | 312 | Species: | Mus musculus |
Alignment Length: | 277 | Identity: | 72/277 - (25%) |
---|---|---|---|
Similarity: | 105/277 - (37%) | Gaps: | 103/277 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDD-PDASTKFQDLGAAYEVLSNPDKRKTYDR 88
Fly 89 CGEECLKKEGM--MD----------HGGDPFSSFFGD---FGFHFGGDG-----QQQDAPRGA-- 131
Fly 132 ----------------------DIVMDLYVSL--EELYS-----------GNFVEIVRNKPV--- 158
Fly 159 ----TKPASGTR---------------------------KCNCRQEMVTRNLGPGRF---QMIQQ 189
Fly 190 TVCDECPNVKLVNEERT 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shv | NP_608525.1 | DnaJ | 22..346 | CDD:223560 | 72/277 (26%) |
DnaJ | 25..87 | CDD:278647 | 27/62 (44%) | ||
DnaJ_C | 131..328 | CDD:199909 | 28/150 (19%) | ||
DnaJ_zf | 160..>195 | CDD:304418 | 12/64 (19%) | ||
Dnajb7 | NP_067292.2 | DnaJ | 3..66 | CDD:278647 | 27/62 (44%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..312 | 72/277 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |