DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Samd13

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:213 Identity:53/213 - (24%)
Similarity:98/213 - (46%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDAS-TKFQDLGAAYEVLSNPDKRKTYDR 88
            ::||:|.|.::|:::::|||:.:||.::|||||..|.:|: .||:.:..||::||:..|||.|||
  Rat     3 NYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDYDR 67

  Fly    89 CGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEELYSGNFVEIV 153
            ......|:|.:...|.|.             .:.:::...|.........:..|:|:||:::   
  Rat    68 SRWSRTKEELIRGDGRDE-------------TNWEEEICSRRPRRTFQTVIEDEDLFSGDYL--- 116

  Fly   154 RNKPVTKPASGTRKCNCRQEMVTRNL----------------------------GPGRFQMIQQT 190
                .|.|.:.:|:.:.....||..:                            |.|:|:::  |
  Rat   117 ----FTGPMTHSRRGSSNFFTVTPIIDTGFSTFVSQESKSSPDDSEAFVPYISHGMGKFRLV--T 175

  Fly   191 VCDECPNVKLVNEERTLE 208
            .|.:..|.|.|..:|.:|
  Rat   176 TCSQIMNGKRVVTKRVVE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 53/213 (25%)
DnaJ 25..87 CDD:278647 26/62 (42%)
DnaJ_C 131..328 CDD:199909 19/106 (18%)
DnaJ_zf 160..>195 CDD:304418 9/62 (15%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 27/63 (43%)
DnaJ 3..66 CDD:278647 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.