DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajc18

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001107060.1 Gene:dnajc18 / 559928 ZFINID:ZDB-GENE-030131-8019 Length:407 Species:Danio rerio


Alignment Length:238 Identity:67/238 - (28%)
Similarity:103/238 - (43%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            ||||:||.|.|.|:..::|||||:||...||||| ..|.|:..|:.:|.||.|||||:||:.||.
Zfish   120 RDFYEILGVPKGASDEDLKKAYRKLALRFHPDKN-CAPGATDAFKAIGNAYAVLSNPEKRQQYDE 183

  Fly    89 CGEECLKKEGMMDHGGDPFS----------SFFGD----------FGFHFGGDGQQQDAPRGADI 133
            .|:     :|..:....|.:          ||..|          |...|||     ..|.|.  
Zfish   184 YGD-----QGPAETSSQPSAQPRQAYARHRSFTRDFEPDISPEELFNIFFGG-----RFPTGN-- 236

  Fly   134 VMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPGRFQMIQQTVCDECPNV 198
             :.:|.:....|: ::.:..|.:|..:          |:|.|..:.....|..:.|.:    |.:
Zfish   237 -IHVYTNGGASYA-HYYQPRRRRPFER----------REEEVEESHSTNNFTPLLQLL----PVL 285

  Fly   199 KLV-----------NEERTLEIEVEQGMVDGQETRFVAEGEPH 230
            .|:           |...:|..:...|:|..:||:.:  |.|:
Zfish   286 VLIVISVFTQLMATNPPYSLFYKPSMGLVVSRETQHM--GVPY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 67/238 (28%)
DnaJ 25..87 CDD:278647 33/61 (54%)
DnaJ_C 131..328 CDD:199909 19/111 (17%)
DnaJ_zf 160..>195 CDD:304418 5/34 (15%)
dnajc18NP_001107060.1 DnaJ 121..182 CDD:278647 33/61 (54%)
DUF1977 299..399 CDD:286411 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.