DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajc16l

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_021335369.1 Gene:dnajc16l / 556590 ZFINID:ZDB-GENE-130530-696 Length:789 Species:Danio rerio


Alignment Length:256 Identity:70/256 - (27%)
Similarity:103/256 - (40%) Gaps:72/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCLVIIQLSLLLVEESFAGR---DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDAST 65
            :.|.....|.|.|..:|.|..   |.|.:|.|.|:|:..|:||.|::||:|.|||||| .|.|..
Zfish    12 VSCCAWAILLLALFGDSLASAPEFDPYSVLGVSKHASLTEIKKMYKKLAREWHPDKNK-SPGAED 75

  Fly    66 KFQDLGAAYEVLSNPDKRKTYDRCGEECLKKEGMMDHG-------------GDPFSSFFGDFGFH 117
            .|..:..:||:|||.::|..|||.|:        ||..             .|.|  :|.:..||
Zfish    76 MFIKITKSYEILSNEERRANYDRFGQ--------MDENQNFARPPQGFRQYHDSF--YFDESFFH 130

  Fly   118 FGGDGQQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPG 182
            |         ||.:   .|...|...|:...::..|......:|                     
Zfish   131 F---------PRTS---RDFTESKHLLHYNQYMNEVLPDSFKRP--------------------- 162

  Fly   183 RFQMIQQTV--CDECPNVKLVNEERTLEIE---VEQGMVD-GQETRFV----AEGEPHIDG 233
              .:|:.|.  |..|.:::.:.::..||:|   |..|:|| |.|.:..    |...|.|.|
Zfish   163 --YLIKITSEWCFTCIHIEPIWKDTVLELEPLGVGIGVVDIGYERQLANHLGAHRTPSILG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 65/238 (27%)
DnaJ 25..87 CDD:278647 28/61 (46%)
DnaJ_C 131..328 CDD:199909 22/113 (19%)
DnaJ_zf 160..>195 CDD:304418 4/36 (11%)
dnajc16lXP_021335369.1 DnaJ 36..>136 CDD:333066 42/122 (34%)
TRX_DnaJ 137..246 CDD:239261 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.