DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and DNAJC10

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:359 Identity:87/359 - (24%)
Similarity:150/359 - (41%) Gaps:107/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QLIKCLVIIQLSLLLVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTK 66
            ::|.|.:|:.:::|:..:    :|||.:|.|.|.|::.|:::|:::||.:||||||.::|:|...
Human    16 RIILCFLIVYMAILVGTD----QDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGD 76

  Fly    67 FQDLGAAYEVLSNPDKRKTYDRCGEECLKKEGMMDHGGDPFSS---FFGDFGFHFGGDGQQQDAP 128
            |..:..|||||.:.|.||.||:.||     :|:.|:.|..:.|   :..|||.:       .|.|
Human    77 FLKINRAYEVLKDEDLRKKYDKYGE-----KGLEDNQGGQYESWNYYRYDFGIY-------DDDP 129

  Fly   129 RGADIV------MDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPGRFQMI 187
               :|:      .|..|:..||:..||                             ..||     
Human   130 ---EIITLERREFDAAVNSGELWFVNF-----------------------------YSPG----- 157

  Fly   188 QQTVCDECPNVKLVNEERTLEIE--VEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMPHPRF 250
                |..|.::.....:...|::  :..|.|:..:.|.:...: .::..|...|.|....|    
Human   158 ----CSHCHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMK-GVNSYPSLFIFRSGMAP---- 213

  Fly   251 LRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVT--WPGARIRKKGEGMPNFENNNL 313
            ::.:.|       ..:::||.|:|:      |:    |..||  |.|           ||.|:..
Human   214 VKYHGD-------RSKESLVSFAMQ------HV----RSTVTELWTG-----------NFVNSIQ 250

  Fly   314 TG-NLYITFDVEFPKKD---LTEEDKEALKKILD 343
            |. ...|.:.:.|..|.   ||.:.:..|..:||
Human   251 TAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 83/339 (24%)
DnaJ 25..87 CDD:278647 28/61 (46%)
DnaJ_C 131..328 CDD:199909 36/207 (17%)
DnaJ_zf 160..>195 CDD:304418 3/34 (9%)
DNAJC10NP_061854.1 DnaJ 34..>132 CDD:223560 41/112 (37%)
PDI_a_ERdj5_N 129..229 CDD:239301 23/152 (15%)
Trxb 1 235..350 16/61 (26%)
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.