DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb1a

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:368 Identity:114/368 - (30%)
Similarity:169/368 - (45%) Gaps:84/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|:||.::|.|:..|:|||||:.|...|||||| ...|..||:::..||:|||:..|:..||
Zfish     2 GKDYYRILGIEKGASDEEIKKAYRKQALRFHPDKNK-SAGAEDKFKEIAEAYDVLSDAKKKDIYD 65

  Fly    88 RCGEECLK-KEGMMDHG------GDP---FSSFFG---DFGFHF---GG--DGQQQDAPRGA--- 131
            |.||:.|| ..|...:|      |||   |:.|||   .|...|   ||  ||...|.|.||   
Zfish    66 RYGEDGLKGHAGSGTNGPSYTFHGDPHAMFAEFFGGRSPFDHFFASAGGPNDGMDIDDPFGAFGM 130

  Fly   132 ---------------------------DIVMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCN 169
                                       .:|.:|.|||||:::|                    |.
Zfish   131 GGMGGFPRSFKSRVGGPHGSREKKKDPPVVHELKVSLEEVFAG--------------------CT 175

  Fly   170 CRQEMVTRNLGPGRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGE 234
            .:.::..:.|.|           |.|   .:.||::.|.:::::|..:|.:..|..||:......
Zfish   176 KKMKISRKRLNP-----------DGC---SMRNEDKILTVDIKRGWKEGTKITFPKEGDETPTNI 226

  Fly   235 PGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIR 299
            |.|::..|:...|..|.|...|:.....|||::||.|.::....|||..|.|:...|..||.:.|
Zfish   227 PADIVFVVKDKIHSVFRRDGSDIIYPARISLREALCGCTINAPTLDGRTVTVSSRDVIKPGMKKR 291

  Fly   300 KKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKIL 342
            ..|||:|..:.....|::.:.|.|:||.| |....:|||.:||
Zfish   292 IVGEGLPLSKCPEKRGDMVLEFSVKFPDK-LGPGAREALVQIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 114/368 (31%)
DnaJ 25..87 CDD:278647 28/61 (46%)
DnaJ_C 131..328 CDD:199909 53/226 (23%)
DnaJ_zf 160..>195 CDD:304418 4/34 (12%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 114/368 (31%)
DnaJ 4..65 CDD:278647 28/61 (46%)
DnaJ_C 157..321 CDD:199909 53/198 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.