DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb4

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 / 445061 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio


Alignment Length:376 Identity:114/376 - (30%)
Similarity:174/376 - (46%) Gaps:90/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:||||.:.|.|:.:::|||||:.|.:.|||||| ..:|..||:::..||||||:|.||:.||
Zfish     2 GKDYYKILGITKGASDDDIKKAYRKQALKWHPDKNK-AANAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    88 RCGEECLKKEGMMDHG----------GDP---FSSFFG--------------------------- 112
            :.|||.||..|....|          |||   |::|||                           
Zfish    66 QYGEEGLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVDGND 130

  Fly   113 DFG----FHFGGDGQQQDAPRGAD--------IVMDLYVSLEELYSGNFVEIVRNKPVTKPASGT 165
            .||    |:..|..:::...:|..        |..:|.|||||::.|:          ||     
Zfish   131 PFGSFTSFNINGFPRERHVGQGGPPRRKQDPAIHHELRVSLEEVFHGS----------TK----- 180

  Fly   166 RKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEP 229
                 |.::..:.|.| ||               .|..|::.|.||:::|..:|.:..|..||:.
Zfish   181 -----RMKISRKRLNPDGR---------------TLRTEDKILTIEIKRGWKEGTKITFPREGDE 225

  Fly   230 HIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWP 294
            ..:..|.|::..::..||..|.|:..|:...|.:||:.:|.|.|:.:..:||....:....|..|
Zfish   226 TPNTIPADIVFVIKDKPHGHFRREGSDIVYPVRVSLRQSLCGCSVTVSTIDGKTCNMKITDVIKP 290

  Fly   295 GARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKILDQS 345
            |.|....|:|:|..:|....|:|.:.|||.|| :.|....|:.||:.|..|
Zfish   291 GMRKVIAGQGLPFPKNPEQRGDLIVEFDVNFP-ESLPTNAKDVLKRHLPVS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 114/376 (30%)
DnaJ 25..87 CDD:278647 31/61 (51%)
DnaJ_C 131..328 CDD:199909 55/205 (27%)
DnaJ_zf 160..>195 CDD:304418 6/35 (17%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 110/368 (30%)
DnaJ 4..65 CDD:278647 31/61 (51%)
DnaJ_C 163..325 CDD:199909 55/197 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.