DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and CG3061

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:131 Identity:50/131 - (38%)
Similarity:69/131 - (52%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYDR 88
            :|:|::|.|.|.|..:|:||||::||.:||||||| .|.|...|:.||.|..||::.:|||.||.
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK-APGAVEAFKALGNAAGVLTDAEKRKNYDL 168

  Fly    89 CG-EECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEEL----YSGN 148
            .| .|  ...|..::||          |.|  |.||..:...|........:|.|||    ::|.
  Fly   169 YGINE--SHNGHGNNGG----------GHH--GHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219

  Fly   149 F 149
            |
  Fly   220 F 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 50/131 (38%)
DnaJ 25..87 CDD:278647 31/61 (51%)
DnaJ_C 131..328 CDD:199909 6/23 (26%)
DnaJ_zf 160..>195 CDD:304418
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 50/131 (38%)
DnaJ 106..167 CDD:278647 31/61 (51%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.