DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dph4

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:70 Identity:27/70 - (38%)
Similarity:44/70 - (62%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNK--DDPDASTK-----FQDLGAAYEVLSNPDK 82
            |||::|||...|:.:|:|.:|::|..:.||||.:  |||:..::     |..:.||:..|.:|.:
  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67

  Fly    83 RKTYD 87
            ||.||
  Fly    68 RKHYD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 27/70 (39%)
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 25/68 (37%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.