DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb11

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_989180.1 Gene:dnajb11 / 394787 XenbaseID:XB-GENE-5742111 Length:360 Species:Xenopus tropicalis


Alignment Length:351 Identity:221/351 - (62%)
Similarity:272/351 - (77%) Gaps:7/351 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CLVIIQLSLLLVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDL 70
            |.:|..|.:::    ..||||||||.|.|.|...|:|||||:||.:||||:|.|||:|..|||||
 Frog    12 CFLIFYLMVIV----SGGRDFYKILGVSKGATVKEIKKAYRKLALQLHPDRNPDDPNAQEKFQDL 72

  Fly    71 GAAYEVLSNPDKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQD--APRGADI 133
            ||||||||:.:|||.||..|||.| |:|.....||.||.|||||||.|||:.:|||  .|||:||
 Frog    73 GAAYEVLSDEEKRKQYDTYGEEGL-KDGHQSSHGDIFSHFFGDFGFMFGGNPRQQDRNIPRGSDI 136

  Fly   134 VMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKCNCRQEMVTRNLGPGRFQMIQQTVCDECPNV 198
            ::||.|:|||:|||||||::|||||.:.|.|.|||||||||.|..||||||||.|:.||||||||
 Frog   137 IVDLEVTLEEVYSGNFVEVIRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNV 201

  Fly   199 KLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTI 263
            ||||||||||:|:|.|:.|..|..|:.|||||||||||||..|::.:.||.|.|:.|||||||:|
 Frog   202 KLVNEERTLEVEIEPGVRDSMEYPFIGEGEPHIDGEPGDLRFRIKVLKHPIFERRGDDLYTNVSI 266

  Fly   264 SLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKK 328
            ||.:||.||.|:|.|||||.|.:.|:|:|.|||::.|||||:|||:|||:.|:|.|||||||||:
 Frog   267 SLVEALTGFEMDIAHLDGHKVHILRDKITKPGAKLWKKGEGLPNFDNNNIKGSLIITFDVEFPKE 331

  Fly   329 DLTEEDKEALKKILDQSSINRIYNGL 354
            .||.|.::.:|:::.|:||.||||||
 Frog   332 QLTMEQRQGVKQLMKQNSIQRIYNGL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 210/325 (65%)
DnaJ 25..87 CDD:278647 42/61 (69%)
DnaJ_C 131..328 CDD:199909 132/196 (67%)
DnaJ_zf 160..>195 CDD:304418 24/34 (71%)
dnajb11NP_989180.1 DnaJ 26..349 CDD:223560 209/323 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9464
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44298
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2491
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.