DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajc5gb

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:71 Identity:30/71 - (42%)
Similarity:50/71 - (70%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRK 84
            |.||...|:.|.::|.|::.::|||||:||.:.|||||.::|:|:.||:::..|..:|::..||:
Zfish    12 SRAGESLYQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNNPEAAEKFKEINNANSILNDETKRQ 76

  Fly    85 TYDRCG 90
            .||..|
Zfish    77 IYDEYG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 27/66 (41%)
dnajc5gbXP_005158621.1 DnaJ 17..79 CDD:395170 24/61 (39%)

Return to query results.
Submit another query.