DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajc5aa

DIOPT Version :10

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001002464.1 Gene:dnajc5aa / 386768 ZFINID:ZDB-GENE-031113-20 Length:202 Species:Danio rerio


Alignment Length:71 Identity:31/71 - (43%)
Similarity:50/71 - (70%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRK 84
            |.:|...|.:|.|.|.|..:::||:||:||.:.|||||.|:|:|:.||:::..|:.:|::|.||.
Zfish    11 STSGESLYHVLGVDKVATVDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILNDPTKRN 75

  Fly    85 TYDRCG 90
            .||:.|
Zfish    76 IYDKYG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ_bact 25..345 CDD:274090 29/66 (44%)
dnajc5aaNP_001002464.1 DnaJ 16..78 CDD:395170 26/61 (43%)

Return to query results.
Submit another query.