DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and mrj

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:200 Identity:62/200 - (31%)
Similarity:90/200 - (45%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPD-ASTKFQDLGAAYEVLSNPDKRKTYDR 88
            |:||||:|.::|..:|||||||:||.:.|||||.|:.| |:.:|::|..||||||:..||:.|| 
  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYD- 66

  Fly    89 CGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEELYSGNFVEIV 153
             ....|.|.   .:.|...|:......:..||.|......|..|.         :.|.|:..   
  Fly    67 -ARATLHKS---SNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDY---------DYYPGSGY--- 115

  Fly   154 RNKPVTKPASGTRKCNCRQEMVTRNLGPGRFQMIQQTVCDECPNVKLVNEERTLEIEV-EQGMVD 217
                  ...||.|..|..|....||:..|            .|..|:..::|.:..|. :.|:.|
  Fly   116 ------GSGSGRRSGNRYQAFTFRNIFEG------------TPFHKMFEKKRRIYDEYGKDGLGD 162

  Fly   218 GQETR 222
            ..::|
  Fly   163 RGQSR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 61/199 (31%)
DnaJ 25..87 CDD:278647 34/62 (55%)
DnaJ_C 131..328 CDD:199909 17/92 (18%)
DnaJ_zf 160..>195 CDD:304418 8/34 (24%)
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 34/62 (55%)
DnaJ 3..66 CDD:278647 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.