DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajc11

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:483 Identity:98/483 - (20%)
Similarity:159/483 - (32%) Gaps:175/483 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSLLLVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPD----ASTKFQDLGA 72
            ::..|.||.....|:|.:|||::.|:..|:|.|||||....||||:: ||:    |...|..:..
  Rat     1 MATALSEEELDNEDYYSLLNVRREASAEELKAAYRRLCMLYHPDKHR-DPELKSQAERLFNLVHQ 64

  Fly    73 AYEVLSNPDKRKTYDRCGEECLKKEG--MMDHGGDPFSSFFGDFGFHF--------GGDGQQQDA 127
            ||||||:|..|..||..|:..|:.||  :::....|     .:....|        ....||:..
  Rat    65 AYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERKRTP-----AEIREEFERLQREREERKLQQRTN 124

  Fly   128 PRGADIV----MDLYVSLEELY---SGN-FVEIVRNK---------PVTK--------------- 160
            |:|...|    .||:...:|.|   ||: |.:|..||         |:|.               
  Rat   125 PKGTISVGVDATDLFDRYDEEYEDVSGSGFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNG 189

  Fly   161 -------------------------------PASG-------TRKC----NCRQEMVTRNLGPGR 183
                                           |..|       |.:|    ||..:..:|.:.||.
  Rat   190 NGGGSINFALRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGL 254

  Fly   184 FQMIQQTV-------------CDECPNVKLVNEERTLE---------------IEVEQGMVDGQE 220
            ..::.:.:             .....|..:|.:.:|..               |..:....|..:
  Rat   255 TTVLARNLDKNTVGYLQWRWGIQSAMNTSIVRDTKTCHFTVALQLGIPHSFALISYQHKFQDDDQ 319

  Fly   221 TRFVAEGEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIK-------- 277
            ||.....:....|       .:.:....|.:.::..|...|:|.:..   |.|:::|        
  Rat   320 TRLKGSLKAGFFG-------TIVEYGAERKISRHSVLGAAVSIGVPQ---GVSLKVKLNRASQTY 374

  Fly   278 ----HLDGHLVP---------------VTREKVTWPGARIRKKGEGMPNFENNNLTGNLYITFDV 323
                ||...|:|               .....:..|..|.:|:.:.....||.            
  Rat   375 FFPIHLTDQLLPSAVFYATVGPLVVYLAVHRLIIRPYLRAQKEKDLEKQRENT------------ 427

  Fly   324 EFPKKDLTEEDKEALKKI-LDQSSINRI 350
               ..|:.::.:||...: |.|.|:.||
  Rat   428 ---ASDILQKKQEAEAAVRLMQESVRRI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 92/467 (20%)
DnaJ 25..87 CDD:278647 29/65 (45%)
DnaJ_C 131..328 CDD:199909 46/325 (14%)
DnaJ_zf 160..>195 CDD:304418 9/104 (9%)
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 29/65 (45%)
Selenoprotein_S 372..>447 CDD:284376 13/89 (15%)
DUF3395 417..549 CDD:288708 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.