DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnajb1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:374 Identity:111/374 - (29%)
Similarity:170/374 - (45%) Gaps:91/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|:.|.:.:.|:.:|:|:||||.|...|||||| :|.|..||:::..||:|||:|.||:.:|
  Rat     2 GKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNK-EPGAEEKFKEIAEAYDVLSDPRKREIFD 65

  Fly    88 RCGEECLKKEG--------------MMDHGGDP---FSSFFGD-------FGFHFGGDGQQQDAP 128
            |.|||.||..|              .....|||   |:.|||.       ||...|.:|...|.|
  Rat    66 RYGEEGLKGGGPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDP 130

  Fly   129 -----------------------------RGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASG 164
                                         :...:..||.|||||:|||                 
  Rat   131 FSSFPMGMGGFTNMNFGRSRPTQEPTRKKQDPPVTHDLRVSLEEIYSG----------------- 178

  Fly   165 TRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGE 228
               |..:.::..:.|.| |:               .:.||::.|.|||::|..:|.:..|..||:
  Rat   179 ---CTKKMKISHKRLNPDGK---------------SIRNEDKILTIEVKRGWKEGTKITFPKEGD 225

  Fly   229 PHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTW 293
            ...:..|.|::..::..||..|.|...|:.....|||::||.|.::.:..|||..:||..:.|..
  Rat   226 QTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIR 290

  Fly   294 PGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKIL 342
            ||.|.:..|||:|..:.....|:|.|.|:|.||.: :....:..|:::|
  Rat   291 PGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPDR-IPISSRTILEQVL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 111/374 (30%)
DnaJ 25..87 CDD:278647 29/61 (48%)
DnaJ_C 131..328 CDD:199909 58/197 (29%)
DnaJ_zf 160..>195 CDD:304418 4/35 (11%)
Dnajb1NP_001382078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.