DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and DNAJB1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens


Alignment Length:378 Identity:111/378 - (29%)
Similarity:172/378 - (45%) Gaps:99/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|:.|.:.:.|:..|:|:||||.|...|||||| :|.|..||:::..||:|||:|.||:.:|
Human     2 GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNK-EPGAEEKFKEIAEAYDVLSDPRKREIFD 65

  Fly    88 RCGEECLKKEGMMDHGG---------------------------DPFSSFFGD------------ 113
            |.|||.||..|.....|                           :||.:|||.            
Human    66 RYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDP 130

  Fly   114 -FGFHFGGDG-----------------QQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTK 160
             .||..|..|                 ::||.|    :..||.|||||:|||             
Human   131 FSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPP----VTHDLRVSLEEIYSG------------- 178

  Fly   161 PASGTRKCNCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFV 224
                   |..:.::..:.|.| |:               .:.||::.|.|||::|..:|.:..|.
Human   179 -------CTKKMKISHKRLNPDGK---------------SIRNEDKILTIEVKKGWKEGTKITFP 221

  Fly   225 AEGEPHIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTRE 289
            .||:...:..|.|::..::..||..|.|...|:.....|||::||.|.::.:..|||..:||..:
Human   222 KEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFK 286

  Fly   290 KVTWPGARIRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKIL 342
            .|..||.|.:..|||:|..:.....|:|.|.|:|.||:: :.:..:..|:::|
Human   287 DVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPER-IPQTSRTVLEQVL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 111/378 (29%)
DnaJ 25..87 CDD:278647 29/61 (48%)
DnaJ_C 131..328 CDD:199909 58/197 (29%)
DnaJ_zf 160..>195 CDD:304418 4/35 (11%)
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 111/378 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.