DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnajb1b

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b / 327244 ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio


Alignment Length:373 Identity:107/373 - (28%)
Similarity:174/373 - (46%) Gaps:87/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|:|.:|.::|.|:.:|:|||||:.|.:.|||||| ...|..||:::..||:|||:|.|:..||
Zfish     2 GKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNK-SAGAEEKFKEIAEAYDVLSDPKKKDIYD 65

  Fly    88 RCGEECLKKEGMMDHG----------GDP---FSSFFGD-------FGFHFGGD----------- 121
            |.|||.||.......|          |||   ||.|||.       ||.:.|.|           
Zfish    66 RFGEEGLKGGAPGGGGGGGNYTYTFQGDPHAMFSEFFGGRNPFEHIFGHNGGMDENMETDDLFAS 130

  Fly   122 ------------------GQQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASGTRKC 168
                              |.:.:..:...::.||.|||:|:::|                    |
Zfish   131 FGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTG--------------------C 175

  Fly   169 NCRQEMVTRNLGP-GRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHID 232
            ..:.::..:.|.| ||...               :|::.|.:||::|..:|.:..|..||:....
Zfish   176 TKKMKISRKRLNPDGRTTR---------------SEDKILTVEVKKGWKEGTKITFPREGDETPS 225

  Fly   233 GEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGAR 297
            ..|.|::..::..|||.:.|...|:.....|:|::||.|..:.:..|||..|.||.:.:..||.:
Zfish   226 NIPADVVFVLKDKPHPVYKRDGSDIIYPAKITLKEALCGCVINVPTLDGRTVKVTSQDIVRPGMK 290

  Fly   298 IRKKGEGMPNFENNNLTGNLYITFDVEFPKKDLTEEDKEALKKILDQS 345
            .|..|||:|..::.:..|:|.:.::|.||:| |::..|:.:..:|..|
Zfish   291 RRLTGEGLPLPKSPDRRGDLVVEYEVRFPEK-LSQNAKDTIANVLPAS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 107/373 (29%)
DnaJ 25..87 CDD:278647 28/61 (46%)
DnaJ_C 131..328 CDD:199909 51/197 (26%)
DnaJ_zf 160..>195 CDD:304418 5/35 (14%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 104/362 (29%)
DnaJ 4..65 CDD:278647 28/61 (46%)
DnaJ_C 160..322 CDD:199909 52/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.