DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and dnaja1

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:368 Identity:125/368 - (33%)
Similarity:187/368 - (50%) Gaps:52/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNP 80
            :|:|:    .||.:|.||.:|:..|:|||||:||.:.|||||   |....||:.:..||||||:.
Zfish     1 MVKET----GFYDMLGVKPSASPEELKKAYRKLALKYHPDKN---PTEGEKFKQISQAYEVLSDA 58

  Fly    81 DKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEELY 145
            .||:.|||.||:.:|:.|   :||.  .|....|...|||.|:.....||.::|..|.||||:||
Zfish    59 KKREVYDRGGEKAIKEGG---NGGS--CSPMDIFDLFFGGGGRMHRERRGKNVVHQLTVSLEDLY 118

  Fly   146 SGNFVEIVRNKPV---TKPASGTRK-----CN-CR---QEMVTRNLGPGRFQMIQQTVCD----- 193
            :|...::...|.|   .....|.||     |. ||   .::...:|.||..|.| .|||:     
Zfish   119 NGTTRKLALQKNVICDKCEGRGGRKGVIEVCPLCRGVGVQVRLHHLAPGMVQQI-STVCEGCQGQ 182

  Fly   194 -----------ECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMPH 247
                       .|...|::.:::.||:.:::||.|||:..|..||:.....:|||:|:.:.|..|
Zfish   183 GQRLGHRDRCKTCTGRKILRQKKILEVHIDKGMKDGQKIVFHGEGDQEPGLKPGDIIIVLDQRAH 247

  Fly   248 PRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIR---KK---GEGMP 306
            |.:.|:.|||..::.:.|.::|.||...||.||...:.:|    :.||..|:   ||   .||||
Zfish   248 PLYTRQGDDLIVSMELQLVESLCGFQKPIKTLDSRTLLIT----SHPGELIKPGDKKCVMNEGMP 308

  Fly   307 NFENNNLTGNLYITFDVEFPKKDLTEEDK-EALKKILDQSSIN 348
            ........|.|.|..:|.||:::....:| :.|::.|.....|
Zfish   309 MHRRPFEKGKLIIHSNVVFPEENFLPLNKLKELERFLPNKQEN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 122/358 (34%)
DnaJ 25..87 CDD:278647 30/61 (49%)
DnaJ_C 131..328 CDD:199909 72/230 (31%)
DnaJ_zf 160..>195 CDD:304418 14/59 (24%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 125/367 (34%)
DnaJ 7..65 CDD:278647 30/60 (50%)
DnaJ_C 104..330 CDD:199909 72/230 (31%)
DnaJ_zf 133..199 CDD:199908 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.