DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment shv and CG32641

DIOPT Version :9

Sequence 1:	NP_608525.1	Gene:	shv / 33220	FlyBaseID:	FBgn0031256	Length:	354	Species:	Drosophila melanogaster
Sequence 2:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster

Alignment Length:	63	Identity:	27/63 - (42%)
Similarity:	40/63 - (63%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
            |:|.||.|..||...|:::||:|:|...|||||| .|..:.:|:.:..|:.|||:...|:.||
  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
shv	NP_608525.1	DnaJ	22..346	CDD:223560	27/63 (43%)
		DnaJ	25..87	CDD:278647	25/61 (41%)
		DnaJ_C	131..328	CDD:199909
		DnaJ_zf	160..>195	CDD:304418
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	25/61 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45458972
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840