powered by:
Protein Alignment shv and CG32640
DIOPT Version :9
Sequence 1: | NP_608525.1 |
Gene: | shv / 33220 |
FlyBaseID: | FBgn0031256 |
Length: | 354 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_727674.1 |
Gene: | CG32640 / 318135 |
FlyBaseID: | FBgn0052640 |
Length: | 132 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 27/63 - (42%) |
Similarity: | 40/63 - (63%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87
|:|.||.|..||...|:::||:|:|...|||||| .|..:.:|:.:..|:.|||:...|:.||
Fly 4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45458971 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.