DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shv and Dnaja4

DIOPT Version :9

Sequence 1:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:362 Identity:126/362 - (34%)
Similarity:185/362 - (51%) Gaps:55/362 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVEESFAGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNP 80
            :|:|:    .:|.||.||.:|:..|:|||||:||.:.|||||   ||...||:.:..||||||:|
  Rat   159 MVKET----QYYDILGVKPSASPEEIKKAYRKLALKYHPDKN---PDEGEKFKLISQAYEVLSDP 216

  Fly    81 DKRKTYDRCGEECLKKEGMMDHGGDPFSSFFGDFGFHFGGDGQQQDAPRGADIVMDLYVSLEELY 145
            .||..||:.||:.:|:.|   .|...|||....|...|||.|:.....||.::|..|.|:||:||
  Rat   217 KKRDIYDQGGEQAIKEGG---SGSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLY 278

  Fly   146 SGNFVEIVRNKPVT---------KPASGTRKCN-CR---QEMVTRNLGPGRFQMIQQTV------ 191
            :|...::...|.:.         |..| ..||. |:   .::..:.:|||..|.| |||      
  Rat   279 NGITKKLALQKNIICEKCEGIGGKKGS-VEKCPLCKGRGMQIHIQQIGPGMVQQI-QTVCIECKG 341

  Fly   192 ----------CDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEPHIDGEPGDLIVRVQQMP 246
                      |::|...|:..|::.:|:.|::||.|||:..|..||:...:.||||:|:.:.|..
  Rat   342 QGERINPKDRCEDCSGAKVTREKKIIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKD 406

  Fly   247 HPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVTREKVTWPGARIRK------KGEGM 305
            |..|.|:..||...:.|.|.:||.||...||.||..::.::.:.    |..|:.      :.|||
  Rat   407 HSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDDRVLIISSKS----GEVIKHGDLKCVRNEGM 467

  Fly   306 PNFENNNLTGNLYITFDVEFPKKDLTEEDK----EAL 338
            |.::.....|.|.|.|.|.||:|.....:|    |||
  Rat   468 PIYKAPLEKGMLIIQFLVVFPEKQWLSLEKLPQLEAL 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shvNP_608525.1 DnaJ 22..346 CDD:223560 124/356 (35%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 70/231 (30%)
DnaJ_zf 160..>195 CDD:304418 14/54 (26%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 126/362 (35%)
DnaJ 165..223 CDD:278647 32/60 (53%)
DnaJ_C 264..490 CDD:199909 70/231 (30%)
DnaJ_zf 293..359 CDD:199908 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.